KEGG   Hahella sp. KA22: ENC22_05290Help
Entry
ENC22_05290       CDS       T05793                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hahe  Hahella sp. KA22
Pathway
hahe00350  Tyrosine metabolism
hahe00360  Phenylalanine metabolism
hahe00380  Tryptophan metabolism
hahe01100  Metabolic pathways
hahe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ENC22_05290
   00360 Phenylalanine metabolism
    ENC22_05290
   00380 Tryptophan metabolism
    ENC22_05290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hahe04147]
    ENC22_05290
Enzymes [BR:hahe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     ENC22_05290
    4.1.1.105  L-tryptophan decarboxylase
     ENC22_05290
Exosome [BR:hahe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ENC22_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AZZ95423
UniProt: A0A3T0VVY4
Position
1202520..1203926
Genome map
AA seq 468 aa AA seqDB search
MTSEEFRRHGYQIIDWIADYWERVEDFPVLSQVAPNEVRSQLPPLPPSAGESLERVFKDL
ENIILPGLTHWQSPNFFAYFPASCSAPSVLGELLCAGLGVQGMLWATSPACTELETHVLD
WLVDMLDLPDKFKSTGSGGGVLQDYASSATLCALLAARERTTEGRSNRAGYQGKLVAYCS
TQTHSSIEKAVRITGLGSDNLRLIEVNDNFAMLPDVLAAQIAKDRREGLVPCFVCATIGS
TSSLAVDPVPEIGRICQQEGLWLHVDAAMAGSAAVCPEFQYLHQGLEYADSYCFNPHKWL
LVNHDCDCFYVADKSALTNALAILPEYLKNVATEAGGVIDYRDWQIPLGRRFRSLKLWLT
IRYYGIEGLQLHIRKHVGLAKLFTDLIEESDSFELAAPPFLNLVCFRHKGDDQTNQRILE
KINKEGQIYLTHTKLNGQYVLRFCVGQIRTEEHHVRRAVDILERVAKC
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagaggaatttcgccgacatggataccagattatcgactggattgctgattac
tgggagcgggtggaggatttccctgttctttcccaggtggctccaaatgaggtgcgctca
caattaccccctttacctcccagtgcaggagagtctttggagagggtgttcaaagacctt
gaaaacatcatcttacccggcctgactcattggcaatcaccaaatttctttgcgtatttc
cctgcttcttgttcagcaccttcggtgttaggagagttgttatgcgccggattaggggtc
cagggtatgttatgggcgaccagtcccgcctgcactgaattggaaacccatgttctggac
tggttggtggatatgctagatctgccggacaaatttaaatccaccggctcggggggcggt
gtgctgcaggattacgccagcagcgccactttatgtgctttattggcggctcgcgaacgc
accaccgaaggacgaagcaaccgggcgggctaccagggaaaactggttgcgtactgttcc
acccaaacccattcctcgatagaaaaggccgttcgtatcactggtcttggtagtgataat
ctgcgcttaatcgaagtaaacgataactttgctatgctccccgatgtgctcgccgcgcag
atagcaaaggatagacgtgaaggtctggttccctgttttgtatgcgctacgataggctcc
acctcatcgttagcggtcgatcctgttcctgaaatcggtcgtatttgccagcaagaaggg
ttgtggctgcatgtggatgccgctatggcgggctcggcggctgtttgtcctgagtttcaa
tatctgcatcagggactggaatacgcagacagttactgttttaacccgcataaatggctg
ttagtcaatcatgactgcgactgcttttatgtcgctgacaaatcagcattgaccaatgcg
ctcgctattttgccggaatacttaaaaaatgtggcgactgaagccggtggcgtaatcgat
tatcgagactggcagatcccgcttgggaggcggttccgctcgctaaaactatggctgacc
atccgttattacggaatcgaaggattgcagttgcatatccgcaaacacgtaggattagcg
aagctatttaccgacttgatagaagaatcagatagctttgagttggcggctccgcccttc
ctcaaccttgtctgcttccgccacaaaggggacgatcaaaccaaccagcgaatcctcgag
aaaatcaacaaagagggacagatctatctgacccacacaaaattaaacggacaatatgta
ttacgattttgtgtcgggcaaatacgaacagaagaacaccacgtgcgcagagcggttgat
atattggaaagggtcgccaaatgctga

DBGET integrated database retrieval system