KEGG   Hahella sp. KA22: ENC22_10975Help
Entry
ENC22_10975       CDS       T05793                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
hahe  Hahella sp. KA22
Pathway
hahe00051  Fructose and mannose metabolism
hahe00520  Amino sugar and nucleotide sugar metabolism
hahe01100  Metabolic pathways
hahe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ENC22_10975
   00520 Amino sugar and nucleotide sugar metabolism
    ENC22_10975
Enzymes [BR:hahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ENC22_10975
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     ENC22_10975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AZZ91697
UniProt: A0A3T0VKG7
Position
2446719..2448128
Genome map
AA seq 469 aa AA seqDB search
MLNAIVLCGGSGTRLWPLSREAYPKQFLNLASDGSLLAETVCRILEISGEAGISVVSNED
HRFLVAATLQVQCPSTKKNIILEPCARNTAPAIALAALDALASDAQAVLLVLPADHVIRN
VQAFADAVRIGEQAAAQGKLVTFGIVPDSPHTGYGYIKADVGDKDWAPVEQFVEKPDLDT
AKSYVDSGNYFWNSGMFMFRADRYLDELKKFRADIYEACTKAYAGKSSDLDFVRVDKRAF
SDCPDDSIDYAVMEKTSDAVVIPLDAGWSDVGSWSTLWEIQDKDAAGNVCRGDVITEDVE
GSYIHSEGRLIAAIGLKNHVIVETDDVVLVADKERVQDVKKLVAQVKQQNRAEHRFHKKV
HRPWGTYEGIAISDRFQVKRIVVNPGGTLSLQKHHHRAEHWVVVKGTASVTRGDEVMLLS
EDQSTYIPLGVVHRLENPGVIPLELIEVQTGSYLGEDDIVRFEDTYGRS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcgattgttttatgtggagggtcaggcacacgcctttggcctttatctaga
gaagcttaccctaagcaatttttgaatttggcttctgacggaagcttactggcggaaact
gtctgcaggatattggaaatcagcggtgaagcaggtattagcgtggtctctaacgaagat
catcgcttcctggtggcggctacattgcaggtgcagtgtccgtccacaaagaaaaatatc
attttagaaccttgcgcccgcaacactgcgccggctatcgcactggctgctttggatgct
ctggcgtcagatgcgcaggcggtattattggtgttgccggcggatcatgttattcgcaat
gtgcaagcatttgctgatgcagtgcgcattggtgagcaggcggctgcgcaagggaagttg
gtgacctttggtattgtgccggattccccgcacacgggttatgggtatatcaaagcggat
gttggcgacaaagactgggcgccagtagagcagtttgttgagaagccggatcttgatacg
gccaagagctatgtggattccggaaattacttctggaacagcggtatgttcatgttccgt
gcggatcgttatttggatgagttgaaaaagttccgggcggacatttatgaggcctgtact
aaagcctatgctggcaagtcctccgatttagatttcgtgcgcgtggataagcgggcgttc
tccgattgcccggatgactccattgactatgcggtgatggaaaagacgtccgatgcagtc
gtgattccgctggatgcgggatggagcgatgtcggttcctggtcgaccttgtgggagatt
caggataaagacgcagccggcaatgtgtgtcgcggcgatgtcatcacggaagacgtcgag
ggctcctatatccattccgaaggtcgcctgatcgcggcgattggtctgaagaatcacgtg
attgtcgagacggatgacgtggtcttggtggcggacaaagagcgtgtgcaggatgttaag
aagctggtggcgcaggtcaagcagcagaaccgcgctgagcaccgtttccataagaaggtg
catcgtccctgggggacttacgagggcatcgcgatatcagatcgctttcaggtaaaacgc
attgtggtgaatcctggcggcacgctttctctgcaaaagcaccatcatcgcgcagagcac
tgggtggtagtgaagggaaccgcaagcgtcacccgcggcgatgaagtcatgctactgagt
gaagatcaatctacctatattccgttgggcgttgtgcatcgcttggagaatccaggggtg
attccgcttgagctcattgaagtgcagacaggaagttatctcggtgaagatgacattgtg
cgctttgaagatacgtacggacgatcgtaa

DBGET integrated database retrieval system