KEGG   Hahella sp. KA22: ENC22_22120Help
Entry
ENC22_22120       CDS       T05793                                 

Definition
(GenBank) hypothetical protein
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
hahe  Hahella sp. KA22
Pathway
hahe00860  Porphyrin and chlorophyll metabolism
hahe01100  Metabolic pathways
hahe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ENC22_22120
Enzymes [BR:hahe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     ENC22_22120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AZZ93743
UniProt: A0A3T0VR90
Position
5029983..5030999
Genome map
AA seq 338 aa AA seqDB search
MPVGKVVEQAIQNGGNDSWVYLLNSPPKEFSSENWSALDEGAYDADYRNSSLARYYEGGF
ALSVQAPCFNTLVSAENYTRRLPSMNANLQKYIDYVVKEVRLLKQSLPVGSQVKYLHWFG
DLVRQLTPAAQTQVMYYLGREFKLSFGADARHVIELDARPESEEALALIKGLGFNIICIN
DPGEYAQSFPIENLKDWLQTIRAFDFKAVYLRLKVTPATVAALSEHLEEILTERPQGILL
SSHKTEFASTSGLEAAQKDFKRRIKSASFIPITQDFFALPWTGLISQGVSCLHGVGLGAF
SYTPHYQLRNATQLDDYYKTLDNSELPARAIRYTQTQL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgccagttggaaaggttgtcgaacaagcgatacaaaatgggggtaatgatagctgggtt
tatttgctcaactccccccctaaagagttctccagtgaaaactggagcgccctggacgag
ggagcctatgacgcggactatcgcaacagctctctggctcgatattatgaaggcgggttc
gcattgagcgttcaggcgccctgctttaatacacttgtcagcgcggaaaattacacccgc
agactcccatctatgaatgcaaatttgcaaaagtacatcgactatgtcgtgaaagaagtg
agactactcaagcaaagcctccccgtcggcagtcaggttaagtacctgcattggttcggc
gatctggttcgccagctcactcccgcagcgcagacgcaggtgatgtactatttaggtcgg
gagttcaaactgagcttcggcgccgacgcacgccatgtcattgaattggacgctcgccct
gagtccgaggaagcgctagccctgatcaaaggattgggcttcaatatcatctgcatcaat
gatcccggcgaatacgcacagtccttccctattgagaaccttaaggattggctgcagacc
attcgggcattcgacttcaaagccgtttacctgcgcctgaaagtgactcctgcgaccgtc
gccgcactatccgagcatcttgaagaaattctgacagagagaccgcaaggcatcctactt
tccagccataaaacggaattcgccagcacatcaggcctggaagccgcgcaaaaagatttc
aagcgacgcattaagtccgcatcgtttatcccgatcacgcaggactttttcgcactaccc
tggacaggcttgattagccaaggagtcagttgcctgcatggcgttgggctgggcgctttt
tcttacacgccccactatcaattgcgcaacgccacacagttggacgactactacaagacc
ctggataacagcgagcttccagcaagagcaattcgctacactcaaacccagttgtaa

DBGET integrated database retrieval system