KEGG   Hahella sp. KA22: ENC22_26295Help
Entry
ENC22_26295       CDS       T05793                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hahe  Hahella sp. KA22
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ENC22_26295 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: AZZ94511
UniProt: A0A3T0VTR3
Position
complement(5954389..5954772)
Genome map
AA seq 127 aa AA seqDB search
MSETSLYDIRVTVRTQFIASQSDPDNNRFVFAYHITILNEGERAAQLLRRRWLIIDGDNK
EQEVTGDGVVGQQPVIQPGASYEYSSGCVLDTEVGAMEGHYEMLADDGHLFNAEIPRFIL
AAPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagacgtctttgtatgatattcgggtaactgtccgcacgcagtttatcgcgtca
caatcggacccggacaataaccgctttgtgttcgcctatcacatcactatccttaatgaa
ggcgagcgtgcggcgcagcttttgcggcggcgctggctgatcattgacggcgacaacaag
gagcaggaggttaccggcgatggtgtggtggggcagcagccggtgattcaacccggcgcg
agctatgaatattccagcggctgcgtattggatacggaagttggcgcgatggaagggcat
tacgagatgctggctgacgatggccatctgttcaacgcggagattccccgttttatactc
gccgcgccccgcgttctgcattag

DBGET integrated database retrieval system