KEGG   Hipposideros armiger (great roundleaf bat): 109371687
Entry
109371687         CDS       T04661                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109371687 (AHRR)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109371687 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 109371687
NCBI-ProteinID: XP_019479900
Position
Un
AA seq 877 aa
MTALGDDGGARVGPGFWGPSDVGQRPRAPIRTRPREPGRAPAPGQVRAQAGWAQARGARD
GSAGSWGREGRRAPPTPRGQLRGAEGGPWGRRAALRGAQTWGPGVRAGSARAPPAASAAR
GSRAGRARRGGAALPGAAWSPRCASRHPRCHRSGPGWAAPTCAPQLRAERPGLKTMIPPG
ECMYAGRKRRKPVQKQKAAAGAERSNPSKRHRDRLNAELDHLASLLPLPPDVVSKLDKLS
VLRLSVSYLRVKSFFQAVQEQCPRQPAASVPSSGDGGARGGSVVLEGRLLLESLNGFALV
VSAEGVIFYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVACGQP
LRSEPGEDAILGQLLRAQDGRAGPSEFSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKF
LFGQKRKALSGTALSPRLSLFCIVVPVLLPSVAEMKMKGAFLRAKHRADFAATTDTKAKA
TRSLCEAELRGKPNYLAGRNNGENGISVFRAQMDACRWARVPARATCLCLRGSPDLVLDP
EGAAGDRARQEHEWVPSSSSGVRARREIHAYDCRFQTPRPMRHLNWVTGKHGQDGAKLKL
ELSRSDPLSVPVVSRVSGLPYPDTPGTIPAGSVSAFKNSPSCHQPPSAYASRASRALRDG
VQSQVHPPNCPFPQGSLESRLPQPSVQRLAAGAYSTEDIKLRGVPMPPGAPCNPMLSLDV
PIKMESDCGSEDAADGYSVSPSQVWLGASDMAKRQLVTFPTRMHLKTEPDSRPHLYAPHL
GHGMPRAPPRPGRELAPVHPAPCMCLEVPPCLCVRGHQPPALGCDCRAPGTPPVIKREPL
DSPPWASHSQGGVPGILPKSALATLVPSTASEYTFLP
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgacggccctgggcgacgatggtggcgccagagtgggcccgggcttctggggcccctca
gacgttgggcagagacctcgggcacctattcggacccgaccccgggagcctggccgggca
cctgcacctgggcaggtgcgcgctcaagccgggtgggcgcaggcgcgaggggcgcgtgac
gggtctgcggggagctggggccgcgaggggcgcagggcaccccccaccccgaggggtcag
ctccgcggggcggagggggggccgtggggacggagggcggcccttcgcggcgcacagacg
tgggggcccggggtccgggcgggaagcgcacgcgcgccccctgccgcctccgccgcgcgc
ggctccagggcggggcgggctcgccggggtggggcggcgcttcccggcgcagcctggtcc
ccgagatgcgcgagccggcatccgcgctgccaccgctccgggcccgggtgggctgccccc
acgtgcgcgccacagctccgcgcagagcggcccggcctgaagacgatgatcccgccaggg
gagtgcatgtacgcggggcggaagagaaggaagcccgtgcagaaacagaaggctgccgcg
ggggccgagaggtcgaacccctccaagcggcaccgggaccgcctcaacgccgagctggac
cacctggccagcctgctgccgctgccgccggacgtcgtctccaagctggacaagctttcg
gtcctgcgtctcagtgtcagttacctccgggtgaagagcttcttccaagccgtgcaggag
cagtgcccgcggcagccggctgccagtgtcccctcatccggagacggcggtgcccgagga
gggtcggtcgtgctggagggacggctgctgctggagtccctcaacggctttgctctggtc
gtgagcgcggaaggggtgatattttatgcatcagccacgatcgcggactatctgggcttc
caccagacggatgtgatgcaccaaaacatttatgactacatccacgtggacgaccgccag
gacttctgccggcagctgcactgggccatggaccccccccaggtggcgtgtggacagccc
ctgcgctcagagccaggagaggacgccatcctgggacagctgctcagggcccaggacggg
cgtgcggggccctcggagttctcagccttcctgacgcgctgcttcgtctgccgcgtgcgc
tgcctgctggacagcacctcgggcttcctgacgatgcagtttcaaggaaaactaaaattc
ctgtttggacagaagaggaaggcgctgtcagggacagccctgtcccctcgcctatcactg
ttctgcattgtggtgcctgtcctcctaccctctgtggcggaaatgaaaatgaagggcgcg
tttttgagggcgaagcacagggcagacttcgcggccacgacggacacaaaagcaaaagct
accaggagtctgtgtgaggcagagttgcgtggaaaacccaattacttagcaggaaggaac
aatggagaaaacggcatttcggtgttcagggcacaaatggacgcctgtcgctgggcccgg
gtcccagccagggccacgtgcctgtgccttaggggcagccctgacctcgtccttgacccc
gagggggctgcaggggacagggcacgccaggagcacgagtgggtgccgagcagctcctcg
ggggtgagggcacggagggaaatacacgcatacgactgccgcttccagacaccgagaccc
atgaggcacctgaactgggtgacaggaaagcacggtcaggacggcgctaagctgaagctg
gagctcagcaggagtgacccgctctctgtgcctgttgtttcccgggtctccggcttgccc
taccccgacaccccaggcaccatccctgccggcagcgtcagtgccttcaagaactccccc
agctgccaccagccccccagtgcctacgccagccgggccagcagagccttgcgggatggc
gttcagagccaggtgcaccctcccaactgccccttcccccaggggagcttggagagccgg
ctccctcagcctagcgtgcagcgcctcgcagcaggagcctattccaccgaggacatcaag
ttgcgaggcgtgcccatgccccctggggccccgtgcaaccccatgttgtcccttgatgtg
cccatcaagatggagagtgactgtgggtcagaggacgcagcagatggctactccgtgtcc
ccaagccaggtgtggctgggagccagtgacatggccaagagacagctggtcactttcccg
acaaggatgcacctgaaaacggagccagactctaggccccatctgtatgccccgcatctg
gggcacggcatgccgagggccccgcccaggcccggcagggagctggccccagtccaccct
gcaccctgcatgtgcctggaggttcccccctgcctctgtgtgcggggccaccagcccccg
gctctgggttgtgactgcagagctcccggaaccccacccgtgatcaagcgcgagccgttg
gactccccaccgtgggcctctcacagccagggtggggtgcctgggattctccctaaaagt
gccttggcaacactggtgccatccacagcctccgagtacactttcctgccatag

DBGET integrated database retrieval system