KEGG   Hipposideros armiger (great roundleaf bat): 109371864Help
Entry
109371864         CDS       T04661                                 

Gene name
PCBD1
Definition
(RefSeq) pterin-4 alpha-carbinolamine dehydratase 1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00790  Folate biosynthesis
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109371864 (PCBD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109371864 (PCBD1)
Enzymes [BR:hai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     109371864 (PCBD1)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109371864 (PCBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 109371864
NCBI-ProteinID: XP_019480163
Position
Un
AA seq 143 aa AA seqDB search
QSSVAWASQADRKEGGSWRTLGLTAGTRGCLGASWSTHWEAGKAHRLSAEERDQLLPNLR
AVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHE
CAGLSERDINLASFIEQVAVSMT
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
cagagctctgtggcttgggcttcccaggcagatagaaaagaaggtggaagttggagaacc
ctaggcctgacagccggaaccagaggctgcttgggagcatcatggagtacccactgggag
gctggcaaagcacacaggctcagtgctgaggagagggaccagctgctgccaaacctgagg
gctgtgggttggaatgagctggaaggccgagacgccatcttcaagcagttccatttcaaa
gactttaacagggcttttggcttcatgacaagagtggccctgcaggctgagaaactggac
caccatcctgagtggtttaacgtgtacaacaaggtccacatcaccctgagcacccacgaa
tgtgcaggcctttcggagcgggacataaacctggccagctttattgagcaagtagccgtg
tccatgacctag

DBGET integrated database retrieval system