KEGG   Hipposideros armiger (great roundleaf bat): 109374464Help
Entry
109374464         CDS       T04661                                 

Gene name
ATP1A3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04260  Cardiac muscle contraction
hai04261  Adrenergic signaling in cardiomyocytes
hai04911  Insulin secretion
hai04918  Thyroid hormone synthesis
hai04919  Thyroid hormone signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04960  Aldosterone-regulated sodium reabsorption
hai04961  Endocrine and other factor-regulated calcium reabsorption
hai04964  Proximal tubule bicarbonate reclamation
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai04972  Pancreatic secretion
hai04973  Carbohydrate digestion and absorption
hai04974  Protein digestion and absorption
hai04976  Bile secretion
hai04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    109374464 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    109374464 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109374464 (ATP1A3)
   04918 Thyroid hormone synthesis
    109374464 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    109374464 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    109374464 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109374464 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    109374464 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    109374464 (ATP1A3)
   04971 Gastric acid secretion
    109374464 (ATP1A3)
   04972 Pancreatic secretion
    109374464 (ATP1A3)
   04976 Bile secretion
    109374464 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    109374464 (ATP1A3)
   04974 Protein digestion and absorption
    109374464 (ATP1A3)
   04978 Mineral absorption
    109374464 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109374464 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109374464 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    109374464 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109374464 (ATP1A3)
Enzymes [BR:hai01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     109374464 (ATP1A3)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109374464 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   109374464 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   109374464 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   109374464 (ATP1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 109374464
NCBI-ProteinID: XP_019484610
Position
Un
AA seq 1031 aa AA seqDB search
MGPGMESGGSDSYRVATSQDKKDDKGSPKKSKGAKERRDMDDLKKEVAMTEHKMSVEEVC
RKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCF
LAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVI
REGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCT
HDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFI
QLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFD
KSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRE
RNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDE
EMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMI
DPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPV
SQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIV
AVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNL
KKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIM
KRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSNLVGIRLNWDD
RTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNK
ILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN
PGGWVEKETYY
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgggcccagggatggagtctggtggctctgacagttatcgtgtcgccacctcgcaggac
aaaaaagatgacaagggctcgcctaagaagagcaaaggcgccaaggagcgccgggacatg
gacgacctcaagaaggaggtggctatgacagagcacaagatgtcagtggaagaggtctgc
cggaaatataacacggactgtgtgcagggtctgacccacagcaaagcccaggagattctg
gcccgggatgggcccaacgcgctcacgccaccgcccaccaccccggagtgggtcaagttc
tgccgccagctcttcgggggcttctccatcctgctgtggatcggagccatcctctgcttt
ttggcctatggcatccaagcgggcactgaggatgatccctctggggataacctgtactta
ggcatcgtgctggcggccgtggtcatcatcaccggctgcttctcctactaccaggaggcc
aagagctccaagatcatggagtccttcaagaacatggttccccagcaagccctggtgatc
cgggaaggtgagaagatgcaggtgaacgctgaagaggtggtggtcggggacctggtggag
atcaagggtggagaccgagtcccggctgatctacgcatcatctcagcccacggctgcaag
gtagacaactcctccctgaccggtgaatcagaaccccagacccgctctcctgactgcaca
catgacaaccccttggagactcggaacatcaccttcttttccaccaactgcgtggaaggc
acggctcggggtgtggtggtggccacaggggaccgcaccgtcatgggccgaattgccacc
ctggcttcagggttggaagtgggcaagacccccatcgccatcgaaatcgagcactttatc
cagctcatcactggtgtggccgtcttcctgggcgtctccttcttcgtcctctccctcatt
ctcggatatagctggcttgaggctgtcatcttcctcatcggcatcattgtggccaatgtc
ccagagggtctgctggccactgtcactgtctgtctgacactgaccgccaagcgcatggcc
cggaagaactgccttgtgaaaaacctggaggctgtagagaccctgggctccacgtccact
atctgctcagacaagacagggaccctcacccagaaccgcatgacggtcgcccacatgtgg
ttcgataaccagatccacgaggctgacactactgaggaccagtcagggacctcgtttgat
aagagctctcacacctgggtggccctgtctcacatcgccggactctgcaatcgggccgtc
ttcaagggcggtcaggacaacatccctgtgctaaagagggatgtggccggcgatgcctct
gagtcagctctgctgaagtgcatcgaattatcctctggctccgtgaagctgatgcgggaa
cgcaacaagaaagtggccgagatccccttcaactccaccaacaaataccagctctccatc
cacgagactgaggatcccaatgacaaccggtacctgctggtgatgaagggcgcccccgag
cgcatcctggaccgctgttccaccatcctgctgcagggcaaagagcagccgctggacgag
gagatgaaggaggccttccagaacgcctacctcgagctcggtggcctgggcgagcgtgtg
ttgggtttctgccattactacctgcccgaggagcagttccccaagggctttgcctttgac
tgcgatgacgtgaacttcacaacggacaacctttgcttcgtgggcctcatgtccatgatt
gacccaccccgggcagccgtccccgatgcagtgggcaagtgccgcagtgcaggaatcaag
gtcatcatggtcacaggcgatcaccccatcaccgcaaaggccattgctaagggtgtgggc
atcatctccgagggcaacgagaccgtggaggacattgctgcccggctgaacattcctgtc
agccaggtcaacccccgggatgccaaggcctgtgtgatccacggcaccgacctcaaggac
ttcacctccgagcaaatcgacgagatcctgcagaaccacacagagattgtctttgcccgc
acgtccccccagcagaagctcatcattgtagagggctgtcagagacagggggcaatcgtg
gctgtgactggggatggtgtgaacgactcccccgctctcaagaaggctgacattggggtg
gccatgggcattgccggctctgacgtctccaagcaggcagcggacatgattctgctggac
gacaactttgcctccattgtcacgggtgtggaggagggccgcctgatcttcgacaacctg
aaaaagtccatcgcctacaccctgaccagcaacatccccgagatcacacccttcctgctg
ttcatcatggccaacatcccactgcctctgggcactatcaccatcctctgcattgacctg
ggcaccgacatggtccccgccatctccttggcatatgaggctgccgagagtgacattatg
aagagacagcccaggaacccacgcactgacaaactggtcaatgagaggctcatcagcatg
gcatatgggcagattggaatgatccaggctctaggtggcttcttctcctactttgtgatc
ctggcagaaaatggtttcttgcccagcaacttggtgggtatccggctgaactgggatgac
cgcaccgtcaatgaccttgaggacagttatgggcagcagtggacgtacgagcagaggaaa
gtggtggagttcacatgtcacacggccttcttcgtgagcattgtggttgtccagtgggcc
gacctgatcatctgcaagacacgcagaaactcggtcttccagcagggcatgaagaacaag
atcctgatctttgggttatttgaggagacagccctcgccgccttcctgtcctactgccct
ggcatggacgtggcccttcgcatgtaccctctcaagcccagctggtggttctgtgccttc
ccctacagcttcctcatcttcgtctatgatgaaatccgcaaactcatcctgcgcaggaac
cccgggggttgggtggagaaggaaacctattactga

DBGET integrated database retrieval system