KEGG   Hipposideros armiger (great roundleaf bat): 109374619Help
Entry
109374619         CDS       T04661                                 

Definition
(RefSeq) BDNF/NT-3 growth factors receptor
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04722  Neurotrophin signaling pathway
hai05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109374619
   04010 MAPK signaling pathway
    109374619
   04151 PI3K-Akt signaling pathway
    109374619
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109374619
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    109374619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109374619
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109374619
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   109374619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 109374619
NCBI-ProteinID: XP_019484907
Position
Un
AA seq 465 aa AA seqDB search
MSSWTRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPTPGIMAFPRLEP
NSADPENITEIYIANQKRLEIINEDDVEAYTGLKNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTNLSRKHFRHLDLSALILVGNPFTCSCDIMWIKTLQETKSSPETQDLYCLNES
SKNIPLVNLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNLYWDVGNLVSKHL
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIDDGADPNYPEVIYEDYGTTASDIDDTTNRSNEIPST
DVADKTGREHLSVYAVVVIASVVGFFLLVMLFLLKLARHSKFGMK
NT seq 1396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggacgaggtggcatggacctgccatggcgcggctctggggcttctgctgg
ttggttgtgggcttctggagggccgctctcgcctgtcccacgtcctgcaaatgcagcgct
tctcggatctggtgcagcgaccctactcctggcatcatggcatttccgaggctggagcct
aacagtgcagatcctgagaacatcaccgaaatttacattgcaaatcagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttacacgggactgaaaaatctgacaattgtggat
tctggattaaaatttgtggctcacaaagcatttctgaaaaatagcaacttacagcacatc
aactttacccgaaataagctgacgaatttgtctaggaaacatttccgtcaccttgacttg
tctgcgctgatcttggtgggcaatccatttacatgctcctgtgatattatgtggatcaag
acacttcaggagactaaatccagtccagaaactcaggatttgtactgcctaaatgaaagc
agcaagaatatccccctggtgaacctgcagatacccaattgtggtttgccgtcagcaaac
ttggccgcacccaacctcactgtggaggaaggaaagtctatcacattatcttgtagtgtt
gcaggcgatccagttccaaatttgtactgggatgttggtaatctggtttccaaacatctg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggctgaaaatcttgtaggagaagatcaagattctgtgaac
ctcactgtgcattttgctccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaagccagcgcttcagtggttctataac
ggggcaatactgaacgagtccaaatacatctgcactaaaatccatgttaccaatcatacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggcgactacaag
ttagtcgccaagaacgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgatgatggtgcagacccaaattatcctgaggtcatttatgaagattat
gggactacagcaagtgacattgatgacaccacgaacaggagtaacgaaatcccttccaca
gatgttgctgataaaactgggcgggaacatctctcggtctatgctgtggtggtaattgca
tctgtagtcgggtttttcctgctggtaatgctgtttctgctgaagttggcaagacactcc
aagtttggcatgaaag

DBGET integrated database retrieval system