KEGG   Hipposideros armiger (great roundleaf bat): 109375093Help
Entry
109375093         CDS       T04661                                 

Gene name
PARP10
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 10
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109375093 (PARP10)
Enzymes [BR:hai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109375093 (PARP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP
Motif
Other DBs
NCBI-GeneID: 109375093
NCBI-ProteinID: XP_019485845
Position
Un
AA seq 995 aa AA seqDB search
MGNTYRLRMGAALSQHSGKSRPGHLLGVKAPAVVVMKEAEAEVGAALELSGLPPNVPDEL
LTLYFENRRRSGGGPVSSWQRFGRGGVLTFREPADAERVLAQGEHELQGARLSLRPAPPR
APARLLLQGLPPGTTPQHLEQHVQALLRATGHPEQPCRALASPRPDRVLVQLPKPLSETE
VCVLEERARTLCLEGNEVSVVRVPQARAVRVLGGHSPVDLLLLELYLENEPRSGGGPLDG
LRSLPGALGTVVSFQQWQAAERVLQQEHWLQGSELSLVPHYDVLEPEGLDDDTSGRGHSA
ESGPGATEHAVLEAGGSVRALRGAGTATLGSEDAPGRSRTSLRTGPIRSLEQAGLVSSGP
MGSLGQEGLESLGLMGSPEQAGLVSSRPIGSPGPVGSMEITTGSPEQEGLESLGPVGAPG
QEGLVEMVLPMEPGAMRFIQLYHEDLLAGLEDVALFPLEESDVAGFRLYGALAPCQAAED
FLQSLLGSMSCHMLSLKHPGSARFLLGPQGQHLLRELEAQFRCVFGTEHLARDTQDMDPG
EVDPTEALQALSGQSYTLSPPGSDQENLNLEEVRELLATLEGLDGEDWPPLELDEGEPEA
EPVPRAGEEPLAPSTGAPGRLEEEAAMQLALHQSLQPQGQLAEQKEAAALQQALALSLLE
PSPWEAGELLGRAAGQAQLVVHVAFEQDLDELDRAVAAALELHLREETVGLRGHMLPAEL
LARLEQCHSVSVALDGDCVVLRGFGAQPSRAARHLAALLAGPRDQSLAFVSEASSPTGPL
QRPKGPLGRLESLAESSREFQEVVQAFYDSLDTGHGKVRIVRVERVVHLLLQQQYELHRE
RLEQRCEQRPAEHVLYHGTTATAVADICAYGFNRSFCGRNGTLYGQGVYFAKRASLSVQD
RYSPPNADGHKAVFVARVLTGDYGQGRRGLRAPPLRAPGHALLRYDSAVDCLHQPSIFVI
FHDTQALPTHLITCEHMPQAPPGNPIGLLGNFLAS
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacttacaggttaaggatgggagctgctctctctcagcactccgggaaatcg
aggcctggtcacctgctgggtgtgaaggccccagcagtggttgtgatgaaggaagcagag
gcagaggtgggggcggcactggagctcagcgggctgccccccaacgtgcccgacgagctg
ctcacactgtacttcgagaaccgccgacgctctggtggggggcctgtgtcgagctggcag
agatttggccgcgggggtgtactcacttttcgggagcctgcagacgcagagcgggtcttg
gcccagggggagcatgagctacaaggcgctaggctcagcctgaggccggccccgccccgc
gcccctgcacgcctactgctccaaggactgccccctggcaccaccccccagcacctggag
cagcatgtccaggccctgctgcgtgccaccggacaccccgagcagccctgccgagctctg
gccagtcctcgaccagacagggtcctggtgcagctgccaaagcccctctctgagacagaa
gtctgcgtgctggaggagcgggcccggaccctgtgcctggaagggaatgaggtgtctgtg
gtgcgggtgccacaggcccgagctgtgcgagtgctggggggccactcccccgtggacctg
ctgctgctggagctgtacctggagaatgagccccgcagcgggggcggccccctggacggc
ctgcgcagcctgcctggggccctgggcaccgtcgtctccttccagcaatggcaggctgcc
gagagggtgctgcagcaggagcactggctgcagggctcagagctgagccttgtcccccac
tacgatgtcctggagcctgaggggctggatgacgacaccagtggaaggggccactcagcc
gagtcggggcctggggccactgagcatgctgtgctggaagctggagggtcagtgagggca
ctgaggggtgcagggactgcgaccttgggctctgaggatgcaccaggacgatcaagaacc
tctctaaggacaggtcccataaggtctctggaacaggccgggctagtcagctcggggccc
atggggtcactgggacaggaggggctggaaagcctggggctcatggggtcaccggagcag
gcagggctggtaagctcaaggcctataggatctccaggcccagtgggctcgatggagatc
accacagggtctccagagcaggaggggttggagagcctggggcctgtgggggcaccgggg
caggaggggctggtggagatggtgctcccaatggagccgggagccatgcgcttcatacag
ctctatcacgaggaccttcttgctggcttggaagacgttgccctcttcccactcgaagaa
tcagatgttgctggctttcggctctatggagccctggccccatgccaggcggccgaggac
tttctgcaaagtctgctaggcagcatgagctgtcacatgctgagcctgaagcacccgggc
agcgccaggttcctgctgggtccacaggggcagcaccttcttcgggagctggaggctcag
ttccggtgtgtctttgggacagagcatctggccagggacacccaggacatggaccctgga
gaggtggaccccactgaggccctccaggccctctctggccagtcctacactctgtcgccc
ccaggcagtgaccaggagaatctgaacctggaggaggtccgagagctgctggccaccctg
gagggcctggacggagaggactggccacccctggagctggatgaaggggaacctgaggca
gagcctgtccccagggctggggaggagcccttggcccccagcacgggggcacctgggcgg
ctggaggaggaggccgcgatgcagctggctctccaccagtcactgcagccacagggccag
ctagctgagcagaaggaggccgccgcgctgcagcaggccctggccctgtcgctgctggag
ccaagcccgtgggaggcgggagagctcctgggtagggctgctggccaggcccagctggtg
gtgcatgtggcctttgagcaggatctggacgaactggaccgggctgtagcggccgccttg
gagcttcacctccgggaggagacggtggggctccggggccacatgctgccggcggagctg
cttgcccgcctggagcagtgccacagcgtgagcgtggcccttgacggtgactgcgtcgtg
ctccgtggctttggggcccagcccagccgtgctgcccgccacttagcggcactgctggct
ggcccccgggatcagagtctggcctttgtctctgaggcttcgagccccaccgggcccctg
cagaggccgaaggggcccttgggcagactggagagtctggccgagagcagcagggagttc
caggaggtggtgcaggccttctacgactcactggacactggccacggcaaggtccgcatc
gtccgggtggagcgcgttgtgcacctgctgctgcagcagcagtatgagctgcaccgggag
cgcctggagcagcgctgtgagcagcgcccggccgagcacgtgctgtaccacggcaccacg
gcaaccgctgtcgctgacatctgcgcctatggctttaaccgcagcttctgcggccgcaac
ggcacactctacgggcagggcgtgtacttcgccaagcgcgcctccctatcggtgcaagac
cgctactcgccccccaacgccgatggccacaaggcggtgttcgtggcgcgggtgctgacg
ggcgactacgggcaaggccgccgggggttgcgggcgccccctctgcgggcccctggccac
gcgctcctacgttatgacagcgccgtggactgccttcaccagcccagcatcttcgtcatt
ttccacgacacccaggcgctgcccacccacctcatcacgtgcgagcacatgccccaagct
cccccagggaaccccattgggctcttgggcaacttcctggccagctaa

DBGET integrated database retrieval system