KEGG   Hipposideros armiger (great roundleaf bat): 109376349Help
Entry
109376349         CDS       T04661                                 

Gene name
ACPP
Definition
(RefSeq) acid phosphatase, prostate
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109376349 (ACPP)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     109376349 (ACPP)
    3.1.3.5  5'-nucleotidase
     109376349 (ACPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF1848
Motif
Other DBs
NCBI-GeneID: 109376349
NCBI-ProteinID: XP_019487797
Position
Un
AA seq 298 aa AA seqDB search
MGSLQHLTQLGMEQHYELGEYIRKRYGKFLNESYKRQQVYVRSTDVDRTLMSAMTNLAAL
FPPEGISVWNPNLPWQPIPVHTVPLSEDRLLYLPFKNCSRFEELLSETLKSEEFQKRLEP
YKDFIETLPKLSGFHGKKLFEIWSNIYDPLFCESVHNFTLPSWATEDTMTKLKELSELSV
LSLYGMHKQKEKARLQGGVLVSEILNHMKSATHPWNQRKLVMYSAPPELKWKYFIEMYYR
NETQHEPHPLTLPGCTPSCPLMKFTELVASVIPRDWHSECMITSSHQEPAFSQGKARR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggttccttgcaacatctcactcagctgggcatggagcagcattatgaacttggagag
tatataaggaaaagatatggaaaattcttaaatgagtcctataaacgtcaacaggtgtat
gttcgaagcacagatgttgaccggactttgatgagtgctatgacaaaccttgcagcccta
tttcccccagagggcatcagtgtctggaaccccaacctaccctggcagcccatcccggtg
cacacagtccctctttctgaagatcggttgctatacctgcctttcaagaattgctcccgt
tttgaagaacttctgagtgagactttgaaatcagaggaattccagaagaggctggaacct
tataaggattttatagaaacattaccaaaactttctggattccatggcaagaaacttttc
gaaatttggagtaacatctacgaccctttattttgtgagagtgttcacaatttcacttta
ccctcctgggccactgaggacaccatgactaagttgaaagaattgtcagaattgtccgtc
ttgtccctctatggaatgcacaagcagaaagagaaagctagactacaggggggtgtcctg
gtcagtgaaatcctcaatcacatgaagagcgcaactcatccatggaaccagagaaaactt
gtcatgtattctgcacctccagaacttaagtggaagtacttcatagagatgtactatcgg
aatgagactcagcacgagccacatcctctcacgctgccaggctgcacccccagctgtcct
ctgatgaagtttactgagctggttgcctctgtgatcccccgagactggcactccgagtgt
atgatcacaagcagccaccaagagccagccttctcacaaggaaaagcaaggagatga

DBGET integrated database retrieval system