KEGG   Hipposideros armiger (great roundleaf bat): 109379078Help
Entry
109379078         CDS       T04661                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00010  Glycolysis / Gluconeogenesis
hai00053  Ascorbate and aldarate metabolism
hai00071  Fatty acid degradation
hai00260  Glycine, serine and threonine metabolism
hai00280  Valine, leucine and isoleucine degradation
hai00310  Lysine degradation
hai00330  Arginine and proline metabolism
hai00340  Histidine metabolism
hai00380  Tryptophan metabolism
hai00410  beta-Alanine metabolism
hai00561  Glycerolipid metabolism
hai00620  Pyruvate metabolism
hai01100  Metabolic pathways
Module
hai_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hai_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
hai_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109379078 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    109379078 (ALDH7A1)
   00620 Pyruvate metabolism
    109379078 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109379078 (ALDH7A1)
   00561 Glycerolipid metabolism
    109379078 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109379078 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    109379078 (ALDH7A1)
   00310 Lysine degradation
    109379078 (ALDH7A1)
   00330 Arginine and proline metabolism
    109379078 (ALDH7A1)
   00340 Histidine metabolism
    109379078 (ALDH7A1)
   00380 Tryptophan metabolism
    109379078 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109379078 (ALDH7A1)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109379078 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     109379078 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     109379078 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109379078
NCBI-ProteinID: XP_019490956
Position
Un
AA seq 566 aa AA seqDB search
MGSRGRGAGLYFSGSRGRRRVAHPGLSMWRLSRHLCVQVARGRKVSELWNKPAAFMSTLL
INQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVK
KAREAWRIWADIPAPKRGEVVRQIGDALREKIQVLGNLVSLEMGKIFVEGVGEVQEYVDV
CDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGVITAFNFPVAVYGWNSAIAMICGD
VCLWKGAPSTSLISVAVTKILAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFT
GSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAIGTAGQRCTTA
RRLFLHESIHDEVVNRLKKAYAQIRVGDPWDPNVLYGPLHTKQAVSMFLGAVEAAKKEGG
TVVYGGKVMDRPGNYVEPTIVTGLAHNASIAHTETFAPVLYVFKFKNEEEVFAWNNEVKQ
GLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggctctcgcgggcggggggcggggctctatttcagcggctcccgaggccgcaggcgc
gttgcacatcccgggctcagtatgtggcgcctatcccgccatctgtgtgtgcaggttgca
agggggcgcaaggtctcagaactttggaacaaacctgcagccttcatgtccaccctgctt
atcaatcagccccagtatgcttggctgaaggagctgggcctccgcgaggaaaacgagggc
gtgtataatggaagctggggaggccggggagaggttatcactacctattgtcctgctaac
aatgagccaatagcaagagtccgacaggccagtgtagctgactatgaggaaactgtaaag
aaagcaagagaagcatggagaatctgggcagacattcctgctccaaagcgaggagaagta
gtgagacagattggtgatgccttgcgggagaagatccaagtactgggaaacttggtgtct
ttggaaatggggaaaatctttgtggaaggtgtgggagaggttcaagagtacgtggatgtt
tgtgattatgctgttggcttatcgcggatgatcgggggacccatccttccctctgaaaga
cctggccatgcgctcattgaacagtggaaccctgtaggcctggttggagtcatcactgca
ttcaacttccctgtggcggtgtatggctggaacagcgccatcgcaatgatctgcggggac
gtctgcctgtggaaaggcgctccatcaacgtcccttatcagtgttgctgtcacaaagata
ttagccaaggttctagaggacaacaagctacctggtgccatttgctccttgacgtgtggt
ggagcggatattggcacggcaatggccaaagatgagcgggtgaacctgctgtccttcacc
gggagcacgcaggtggggaaacaggtggcccttatggtacaggagagatttgggagaagc
ttgttagaacttggaggaaacaatgccattattgctttcgaggatgcggacctcagctta
gtggttccgtcagctctctttgcggccatcgggacagccggccagaggtgtaccactgcg
aggcgcctgtttttacatgaaagtattcatgatgaagttgtaaatcgacttaaaaaggcc
tatgcacagatccgggttggggacccatgggaccctaatgttctctatgggccactgcac
accaagcaggcagtgagcatgtttcttggagccgtggaggctgccaagaaagaaggtggc
acagtggtgtatggtggcaaggttatggatcgccctggaaattatgtggaaccgaccatt
gtgacaggtcttgcccacaacgcatccattgcacacacagagacttttgctccagttctt
tatgtctttaaattcaagaatgaagaagaggtctttgcgtggaataacgaagtaaaacag
ggactttcaagtagcatctttaccaaggacttgggcagaatcttccgctggcttgggcca
aaaggatctgactgtggcattgtgaatgtcaatattccaacgagtggagctgagattgga
ggtgcctttggaggagaaaagcacaccggtggtggcagggagtctggtagtgatgcctgg
aaacagtacatgagaagatctacttgtaccatcaactacagtaaggaccttcctctggcc
caaggaatcaagtttcagtga

DBGET integrated database retrieval system