KEGG   Hipposideros armiger (great roundleaf bat): 109379258Help
Entry
109379258         CDS       T04661                                 

Gene name
NOP58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    109379258 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hai03009]
    109379258 (NOP58)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    109379258 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 109379258
NCBI-ProteinID: XP_019491298
Position
Un
AA seq 536 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAQLSELLTEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKAEKYE
HKSEVKTYDPSGDSTLPTYSKKRKIEQVDKEDEVIEKKAKKAKVKIKVEEVVEEEEEEEE
VLVVEEQETSMKKKKKKDKKKHIKEEPLSEEEPCTSTAVPSPEKKKKKKKKKDNED
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgctgtttgaaacgtccgtcggctacgccatctttaaggttttgaatgagaag
aaacttcaagaagttgatagtttgtggaaagaatttgaaactccagagaaagcaaataaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagccctgatggagggcaaaatcaataagcagctgaagaaagttctgaagaaaatagta
aaagaagcccatgagcccctggctgtagctgatgctaaactaggaggggttataaaggaa
aagctgaatctcagttgtatccatagtcctgttgttaatgaacttatgagaggaattcgt
tcacagatggatggattaattcctggggtagaaccacgtgaaatggcagctatgtgtctt
ggattggcacacagcttgtcccgatacagactgaaatttagcgcagataaagtggacaca
atgattgttcaggcaatttccttgttggatgacttagataaagaactaaacaactacatt
atgcggtgtagagaatggtatggctggcatttccctgaattaggaaaaattatttcagat
aatttgacatactgcaagtgtttacagaaagttggcgatagaaagaattatgcctcggcc
caactttctgaattactgacagaagaagttgaagcagaagtcaaagcagctgcagagata
tctatgggaacagaggtttcagaagaagatatttgcaacattctgcatctctgcactcag
gtgattgaaatctcagaatatagaacccagctctatgaatacctgcaaaatcgaatgatg
gccattgcacccaatgttacagtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaaacatgcagcttctacagttcagattcttgga
gcagaaaaggcactcttcagagctctaaagtctagacgagatacccctaagtatggtctt
atttatcatgcttcacttgtaggacagacaagtcccaaacacaaaggaaagatttctcga
atgttggcagccaaaactgttttggctatccggtatgatgcttttggtgaagattccagt
tctgcaatgggagttgagaacagagccaaattagaggccaggttgaggaccttggaagat
agagggataaggaaaataagtggcactggaaaggcattagcaaaagcagaaaaatatgaa
cataaaagtgaagtgaagacttacgatccttctggtgactctacactgccaacgtattct
aaaaaacgtaagatagaacaggtagataaagaggatgaagtaattgaaaagaaggccaaa
aaagctaaggtgaaaattaaagttgaagaagtagtagaagaagaagaagaagaggaagaa
gtactagtggtggaagaacaggagacatctatgaagaagaagaagaaaaaggacaagaag
aaacacattaaggaagaaccactttctgaggaagaaccatgcaccagcacagcagttcct
agtccagagaaaaagaagaaaaagaaaaaaaagaaagataatgaagactag

DBGET integrated database retrieval system