KEGG   Hipposideros armiger (great roundleaf bat): 109380068Help
Entry
109380068         CDS       T04661                                 

Gene name
CHRNA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04080  Neuroactive ligand-receptor interaction
hai04725  Cholinergic synapse
hai05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109380068 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    109380068 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    109380068 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109380068 (CHRNA4)
Ion channels [BR:hai04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   109380068 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 109380068
NCBI-ProteinID: XP_019492790
Position
Un
AA seq 629 aa AA seqDB search
MELGGPGALPPPPLALLLLLGVGLLPASSHVETRAHAEERLLRKLFSGYNKWSRPVANIS
DVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIW
RPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKF
GSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEVYPDITYAFII
RRLPLFYTVNLIIPCLLISCLTVLVFYLPSQCGEKVTLCISVLLALTVFLLLITEIIPST
SLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHSMPAWVRRVFLDAVPRLLLMK
RPSVVKDSCRRLIESMHMAADAPRLWPEPKGEPHPVSRAQSWGPSPSPSFCGPLDEPVKP
QPAYKPPSDHVPALEPSEAQEASPCPSPSPSRPPTGSGAPGLAKARSLSVQHMSSPSKAA
EGGVRCRSQSIQYCVPRDQAASQADGQMDSSPTSLKVPPAELPPPDQASPCKCKCKKEPS
RGSSNTVLRARSTKTPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVI
DRIFLWVFVIVCLLGTVGLFLPPWLAGMI
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgggggtccgggggcgctgccgcctccgccgctggcgctgctgctgctgctg
ggggtcggcctcctgcctgcgagcagccacgtggagacccgggcccacgcagaggaacgg
ctgctgaggaaactcttctctggctacaacaagtggtcccggcctgtggccaacatctcg
gatgtggtccttgtccacttcggcctgtcgatcgcacagctcattgacgtggacgagaag
aaccagatgatgacaacaaacgtgtgggtgaagcaggagtggcatgactataagctgcgc
tgggaccctggcgactatgagaatgtgacctccatcagaatcccctctgagctcatctgg
cggccagacatcgtcctgtacaacaacgcggacggggactttgcggtcacccacctgacc
aaggcccacctgttccacgacgggcgggtgcagtggacgccccccgccatctacaagagc
tcctgcagcatcgatgtcactttcttccccttcgaccagcagaactgcaccatgaagttt
gggtcctggacgtacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggac
cagctggacttctgggagagtggcgagtgggtgatcgtggacgccgtgggcacctacaac
accaggaagtacgagtgctgcgccgaggtctacccggacatcacgtacgccttcatcatc
cggcgcctgccgctcttctacacggtcaacctcatcatcccctgcctgctcatctcctgc
ctcacggtcctcgtcttctacctgccgtcccagtgcggcgagaaggtgacgctgtgcatc
tcggtgctgctggcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacc
tcgctggtcatcccgctcatcggcgagtacctgctcttcaccatgatcttcgtcacgctg
tccatcgtcatcaccgtcttcgtgctcaacgtgcaccatcgctccccgcgcacacacagc
atgcccgcctgggtgcgccgcgtcttcctggacgccgtgccgcgcctgctgctcatgaag
cggccgtcggtggtgaaggacagctgccggcggctcatcgagtccatgcacatggcggcc
gacgccccgcgcctctggcctgagcccaagggggagccccaccccgtgagcagagcccag
agctggggcccctcgcccagcccgtctttctgcggccccctggacgagcccgtcaagccc
cagcctgcctacaagccgccctcagaccacgtccccgccctggagccctcagaggcccag
gaagccagcccctgcccctcgcccagcccctcccgcccacccaccggctccggggccccc
gggctcgcgaaagcccggtccctgagcgtccagcacatgtccagccccagcaaagcagcg
gagggcggcgtccggtgcaggtctcagagcatccagtactgtgttccccgagaccaggct
gcctctcaggccgatggccagatggacagctcccccacctccctgaaggtccccccagcg
gagctcccacccccagaccaggcctctccgtgtaaatgcaaatgcaagaaggagccgtcc
agagggtcctccaacactgtcctgagagcccgcagcaccaagaccccaccccagcacctg
cccctgtcgccggccctgacgcgggcagttgagggtgtccagtacatcgcagaccacctg
aaggcagaagacacagacttctcggtgaaggaagactggaagtacgtcgccatggtcatc
gaccgcatcttcctctgggtgtttgtcatcgtctgcctgctgggcaccgtgggtctcttc
ctgccgccctggctggccggcatgatctag

DBGET integrated database retrieval system