KEGG   Hipposideros armiger (great roundleaf bat): 109380255Help
Entry
109380255         CDS       T04661                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04260  Cardiac muscle contraction
hai04261  Adrenergic signaling in cardiomyocytes
hai04921  Oxytocin signaling pathway
hai05410  Hypertrophic cardiomyopathy (HCM)
hai05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109380255 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109380255 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109380255 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    109380255 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109380255 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    109380255 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    109380255 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109380255 (CACNG5)
Ion channels [BR:hai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109380255 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716 Claudin_3 DUF373 DHHC
Motif
Other DBs
NCBI-GeneID: 109380255
NCBI-ProteinID: XP_019493182
Position
Un
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQMTSESTVSVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFSYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctgcgggaggaaggccctgaccctgctgagcagcgtctttgccgtctgtggc
ctggggctcctgggcatcgcggtcagcaccgactactggctgtacctggaggagggtgtg
gtcctgccccagaaccagagcacggagatcaagatgtccctgcactccggcctgtggcgg
gtctgcttcctcgcaggagaggagcgaggacgctgcttcaccatagaatatgtgatgcct
atgaacactcagatgacgtccgagtccacggtcagcgttctaaaaatgattcgctcggcc
acaccgttccctctggtcagcctcttcttcatgttcattgggtttatcctgagcaatatc
ggacacatccgtccccacaggacgatactggcctttgtctctggcatctttttcatcctc
tcaggcctctctctcgtggtgggcctggtgctctatatctccagcatcaacgacgagatg
cttaacaggaccaaggatgcggagacctatttcagctacaagtatggctggtcgtttgcc
ttcgctgccatctccttccttttaacagagagtgctggggttatgtctgtgtatctgttc
atgaagaggtacaccgccgaggacatgtacaggcctcaccctggcttctaccgcccgcgt
ctgagcaactgctctgattactcaggccagttcctacacccagatgcctgggtccggggc
cgcagcccctccgacatctccagcgacgcctccctgcagatgaacagcaactacccagct
ttgctcaagtgccccgactacgaccagatgtcatcttccccctgctga

DBGET integrated database retrieval system