KEGG   Hipposideros armiger (great roundleaf bat): 109382057
Entry
109382057         CDS       T04661                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109382057 (AKAP5)
Protein phosphatases and associated proteins [BR:hai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     109382057 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 109382057
NCBI-ProteinID: XP_019496847
Position
Un
AA seq 435 aa
MEPPVSEIQVETKDEKRSAEVSPQDERQEGKASMLCFKRRKKSAKAMKPKAGSEAADVAR
KCRPETASDQPQPPGGAWASIKHLVTRRKRSESSKQQKPSEAKVQPEINAEDVDLSKQKA
KSRLKIPCIKFSKREKRSNHSKIIEDADRSIRVHGEAERLDTKTPTQSGDQAPKTKSIQD
GSGEFSQKGGDEVCESNVSNSITSPGEEVVSVELGLDPEHSAIHTGTLVLEKEVEKIEEE
QSVQPQQASPLETSETEQQLPAASDAPPSPADAPPSPATPEQQIGDEARNNTLESEPNWR
DYESGEIVAEVSKPEESELSQESDFKEIEINAEKPKPEESKRMEPIAIIITDTEISEFDV
KKSKNVPKQFLISTENEQVGVFANDSGFEGRTSEQYETLLIETASSLVSNAIQLSIEQLV
NEMASDDNKINNLLQ
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggagcccccagtttctgaaattcaggtagaaaccaaagatgagaagagatcagcggaa
gttagtcctcaggatgagaggcaggagggaaaagcatcgatgctttgcttcaagagaaga
aagaaatcagccaaagcaatgaagcccaaagctggctctgaagctgctgatgtggcaagg
aaatgtcgcccagaaacagcctctgatcagccacagcccccagggggagcctgggcctcc
atcaaacatcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagccctct
gaggctaaagtgcaacctgaaatcaatgctgaggatgttgacctttctaaacaaaaggca
aaatccagacttaagattccctgcataaaattctcaaagagggagaaaagaagtaatcat
tccaaaattatagaagatgcagaccgcagcatcagagttcatggagaggctgaaaggttg
gatacgaaaactccaacccaatcaggtgaccaggcaccaaagaccaagtcgatccaggat
ggaagtggagaattctcccagaaagggggtgatgaggtctgtgaatcaaacgtgagcaac
agcataacttctcctggagaggaagtggtttcagtagaacttggtttagatccagagcac
tctgcaattcacacaggaactctagtccttgaaaaagaggttgaaaagattgaggaagaa
caaagtgtccaaccccagcaagcaagcccactggagacttcagaaacagaacagcagtta
cccgccgcttcggatgctcccccatcacctgcggatgctcccccatcacctgcaacccca
gagcaacaaattggggacgaagccagaaacaataccctagaaagtgaaccaaattggaga
gactatgaaagtggagagattgtagctgaagtgagtaagccagaggagtctgaactgagc
caggaatcagattttaaagaaattgagatcaacgcagagaaacccaaaccagaagaaagc
aaaagaatggagccaattgctattattattacggacactgaaatcagtgaatttgacgtt
aagaaatctaaaaatgtccctaagcagttcttaatttcaactgaaaatgagcaagtaggg
gtttttgctaatgatagtggttttgagggtagaacttcagaacaatatgaaacgctctta
atagaaacagcttcctctcttgtcagcaatgctatccagttgtctatagaacagctggtt
aacgaaatggcctctgacgataataaaataaacaatcttctacagtga

DBGET integrated database retrieval system