KEGG   Hipposideros armiger (great roundleaf bat): 109384127
Entry
109384127         CDS       T04661                                 

Gene name
ACY3
Definition
(RefSeq) aminoacylase 3
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109384127 (ACY3)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     109384127 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 109384127
NCBI-ProteinID: XP_019500700
Position
Un
AA seq 319 aa
MCSWPVPREPLRRVAVTGGTHGNEMSGVYLAQHWLRAPGELQRPSFSAMPVLANPAATAA
CRRYVDRDLNRTFTSTFLTARAHPDDPYEVKRARELNQLLGPKASGRAFDFILDLHNTTA
NMGTCLISESTHNVFAMHLCRHLQMQSPELPCRVLLYQVPGEESYSLYSVAKNGMGLELG
PQPQGVLRADLSTRMRALVAAALDFIQLFNQGTAFPAFEMEGYRAIRGMDFPRTEAGDLA
GTVHPQLQDRDFEPLRPGAPIFQMFSGEDVLYEGEATVYPVFINEAAYYEKGIAFLQTEK
LTFSVPALSMLAPAPTPDP
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtgctcgtggcctgtgccccgagagcctctgcgccgcgtggcagtgaccgggggcacc
catggcaatgagatgtctggcgtctacctggcccagcactggctgcgggccccgggggag
ctgcagagacccagcttctccgccatgcctgtgttggccaacccggcggccacagccgcc
tgccgtcgctacgtggaccgtgacctcaaccgcaccttcactagcaccttcctcactgcc
agggctcacccagatgacccatacgaggtgaagagggcccgagagctgaaccagctgctg
gggcccaaggcctcaggccgggcctttgacttcatcctcgacctgcacaacaccacggcc
aacatgggcacctgcctcatctcggaatctacccacaatgtctttgccatgcacctgtgc
cgccacctacagatgcagagccctgagctgccctgcagggtcctcctgtaccaggtgcct
ggggaggagagttacagcctgtattcggtagccaagaacggaatgggcctggaactgggt
ccccagcctcagggcgtgctgcgggccgacctttccaccaggatgagggctttggtggct
gcagctctggacttcatccagcttttcaaccagggcacagcttttcctgcctttgagatg
gaagggtacagagccattaggggcatggacttcccacgcaccgaggccggggacttggcg
ggcaccgtgcatcctcagctgcaggaccgcgactttgagccactgcggcccggtgcaccc
atcttccagatgttcagtggcgaggacgtgctctatgagggggaggccactgtgtatccc
gtattcatcaacgaggctgcctactatgagaagggcattgccttcttgcagactgagaag
ctcacgttctctgtgcccgccctgtccatgctggcccccgcccccaccccagatccctaa

DBGET integrated database retrieval system