KEGG   Hipposideros armiger (great roundleaf bat): 109386602Help
Entry
109386602         CDS       T04661                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04260  Cardiac muscle contraction
hai04261  Adrenergic signaling in cardiomyocytes
hai04921  Oxytocin signaling pathway
hai05410  Hypertrophic cardiomyopathy (HCM)
hai05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109386602 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109386602 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109386602 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    109386602 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109386602 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    109386602 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    109386602 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109386602 (CACNG3)
Ion channels [BR:hai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109386602 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 109386602
NCBI-ProteinID: XP_019505485
Position
Un
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHTFLQFHNSTPKEFK
DALHNDPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtgggggccttcgcagct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaacgaagaagtaatgacccat
tcggggctgtggaggacctgctgcctagaaggggccttccgcggggtctgcaagaagata
gatcacttcccagaagacgccgactacgaacaggatacagccgagtacctcctgcgggcc
gtgagggcctccagcgtcttccccatcctcagcgtcacgctgctcttcttcggcgggctc
tgcgtggcagccagcgagttccaccgcagcagacacaacgtcatcctcagcgcgggcatc
ttttttgtctctgcagggctaagcaacattatcggcatcatagtttatatatccgccaac
gccggggaccccgggcagcgcgactccaaaaagagctactcgtacggctggtccttctac
ttcggcgccttctccttcatcatcgccgagatcgtgggggtggtcgccgtgcacatctac
atcgagaagcatcagcagctgcgcgccaaatcccactcggagctcctgaagaaatccact
ttcgcgcgcctcccgccctataggtaccggttccggagacggtcaagttcgcgctccacg
gagcccaggtcccgggacctgtcccccatcagcaaaggcttccacaccatcccatccacc
gacatctccatgttcaccctctcccgggacccctccaagatcaccatggggaccctcctc
aactccgaccgggaccacacttttctacagttccacaactccacgcccaaagaattcaag
gacgccctgcataacgacccggccaacaggcgcaccacgccggtctga

DBGET integrated database retrieval system