KEGG   Hipposideros armiger (great roundleaf bat): 109388158Help
Entry
109388158         CDS       T04661                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109388158 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109388158 (CREM)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109388158 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf KfrA_N Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 109388158
NCBI-ProteinID: XP_019508160
Position
Un
AA seq 378 aa AA seqDB search
MSKCGRKKYIRTNLRQMTMETIESHQDGRVTDSMAEGGSAHMQTQTGQNSIPTLAQASYR
RGLMILQESWEKKVSVAGSGTGRGSPDVTLVQLPSGQTIHVQGVIQTPQPSVIQSPQIQT
VQVATIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVHGVVPKIEEEKSEEE
GTPPNIATMAVPTSIYQTSTGQYIAIAQGGAIQISNPGSDGVQGLQALTMTNSGAPPPGA
TLVQYAAQSADGTQQFFVPGSQVVVQDEEIELAPSHMAAATGDMPTYQIPAPTTGLPQGV
VMAASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNK
TLIEELKALKDLYCHKAE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatattaggacaaatctaagacaaatgaccatggaa
acaattgagtctcatcaggatggacgtgtaacagattccatggcagagggcggatctgct
catatgcagacccagactggtcaaaattcaatccctactttagctcaggcatcctataga
agaggattgatgattcttcaggagagctgggaaaaaaaggtttctgtagctggatcaggc
accggaagaggctccccagatgtaactctagtacagttaccttcaggccaaaccatacat
gtccagggagtaattcagacaccacagccatcggttattcagtcaccacaaatacaaact
gttcaggtagcaacaattgcagagacagatgagtctgcagaatcagaaggtgtaattgat
tctcataaacgtagagaaatcctttcacgaagaccctcttatcgaaaaatactgaatgaa
ctttcctctgatgtgcatggtgttgttcccaagattgaagaagaaaaatcagaggaagaa
ggaacgccacctaacatcgctaccatggcagtaccgactagcatatatcagactagcacg
gggcaatacattgctatagcccaaggtggagcaatccagatttctaacccaggatctgat
ggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctccaccaggtgct
acacttgtacagtatgcagcacagtcagctgatggcacacagcagttctttgtcccaggc
agccaggttgttgttcaagatgaggaaattgaacttgccccaagtcacatggctgctgcc
actggtgacatgccaacttaccagatcccagctcctactactggtttgccccagggagta
gtgatggctgcctcaccaggaagtttgcatagccctcagcaactcgcagaagaagccaca
cgcaaacgagagctgaggctaatgaaaaacagggaagctgcccgggagtgtcgcaggaag
aagaaagaatatgtcaaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaag
actctcattgaggaactcaaggccctcaaagatctttattgccataaagcagagtaa

DBGET integrated database retrieval system