KEGG   Hipposideros armiger (great roundleaf bat): 109388334Help
Entry
109388334         CDS       T04661                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00020  Citrate cycle (TCA cycle)
hai00480  Glutathione metabolism
hai01100  Metabolic pathways
hai01200  Carbon metabolism
hai01210  2-Oxocarboxylic acid metabolism
hai01230  Biosynthesis of amino acids
hai04146  Peroxisome
Module
hai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hai_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109388334 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109388334 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109388334 (IDH1)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     109388334 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 109388334
NCBI-ProteinID: XP_019508501
Position
Un
AA seq 414 aa AA seqDB search
MSQKIHGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGSPKMTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKSWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELGLFSKTLE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKMKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaaaatccatggcggttctgtggtagagatgcaaggagatgaaatgacgcga
atcatttgggagttgattaaagaaaaactcatttttccgtacgtggaattggacctgcac
agctatgatttaggcatagagaatcgagatgccaccaatgaccaggtcaccaaggatgct
gcagaagctataaagaagtacaatgttggcgtcaagtgtgctaccattactcctgatgaa
aagagggttgaggaattcaagttgaaacaaatgtggaagtcgccaaatggcaccatccga
aatattctgggtggcactgtctttagggaagctattatctgcaaaaatatcccccggctt
gtgagcggatgggtaaaacccatcatcataggtcgtcatgcttatggggatcaatacaga
gcaaccgatttcgttgttcctggtccaggaaaagtagagataacctacacgccaagtgat
gggtccccaaaaatgacgtacctggtacataactttgaagagggtggtggtgttgccatg
gggatgtacaatcaagataagtcaattgaagattttgcacacagttctttccagatggct
ctgtctaagagttggcctttgtatctgagcaccaaaaacaccattctgaagaaatacgat
ggacgttttaaagacatctttcaggaaatatatgacaagcagtacaagtcccaatttgaa
gcccagaaaatctggtatgagcacaggctcatcgatgacatggtggcccaagccatgaaa
tcagagggaggcttcatttgggcctgtaaaaactatgatggcgatgtccagtcggactcc
gtggcccaaggttatggctctcttggcatgatgaccagtgtgctgatttgtccagatggc
aagacagtagaagcagaggctgcccatgggactgtaacccgtcactaccgcatgtaccag
aagggacaggagacatccaccaatcccattgcttccatttttgcctggaccagagggtta
gcccacagagctaagcttgataacaataaagaactcggcttgttttcaaagactttggag
gaagtctgtattgagaccattgaggctggcttcatgaccaaggatttggctgcttgtatt
aaaggtttacccaatgtgcaacgttctgactacttgaatacgtttgagttcatggacaaa
ctcggagaaaacttgaagatgaaactagctcaggccaaactttaa

DBGET integrated database retrieval system