KEGG   Hipposideros armiger (great roundleaf bat): 109388840Help
Entry
109388840         CDS       T04661                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04071  Sphingolipid signaling pathway
hai04270  Vascular smooth muscle contraction
hai04350  TGF-beta signaling pathway
hai04360  Axon guidance
hai04510  Focal adhesion
hai04530  Tight junction
hai04611  Platelet activation
hai04670  Leukocyte transendothelial migration
hai04810  Regulation of actin cytoskeleton
hai04921  Oxytocin signaling pathway
hai05135  Yersinia infection
hai05163  Human cytomegalovirus infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109388840 (ROCK1)
   04071 Sphingolipid signaling pathway
    109388840 (ROCK1)
   04024 cAMP signaling pathway
    109388840 (ROCK1)
   04022 cGMP-PKG signaling pathway
    109388840 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109388840 (ROCK1)
   04530 Tight junction
    109388840 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109388840 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109388840 (ROCK1)
   04670 Leukocyte transendothelial migration
    109388840 (ROCK1)
   04062 Chemokine signaling pathway
    109388840 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109388840 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109388840 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    109388840 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109388840 (ROCK1)
   05206 MicroRNAs in cancer
    109388840 (ROCK1)
   05205 Proteoglycans in cancer
    109388840 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109388840 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109388840 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109388840 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109388840 (ROCK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109388840 (ROCK1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109388840 (ROCK1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109388840 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 HR1 APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 109388840
NCBI-ProteinID: XP_019509413
Position
Un
AA seq 1284 aa AA seqDB search
MKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAF
ANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIH
SMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQG
GDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAK
NLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDD
LEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYVSSANPNDNRTSSNADKSLQESLQK
TIYKLEEQLHNEIQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKML
LQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLASEKLAQLQKQLEEA
NDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRVLENSKTQTDKEYYQLQAAF
EAERRDRGHDSEMIGDLQARITSLQEEVKHLKYNLERVEGERKEAQDMLNHSEKEKNNLE
IDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMYEMEKKLKEEREAREKA
ENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLQLEQESNKRLLLQNEL
KTQAFEADNLKGQEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQ
YFSTLYKTQVKELKEEIEEKNRENFKKIQELQNEKETLSTQLDLAETKAESEQLARGLLE
EQYFELTQESKKAASRNRQEITDKDHAVSRLEETNSMLTKDIELLRKESEELTDKMRKAE
EEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKK
EKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQLASKESDIEQL
RAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKKQYVVVSSKKI
LFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDV
EMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHR
DHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPR
TLSTRSTANQSFRKVVKNTAGKTS
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgaagattatgaagtggtgaaggtgattggtagaggtgcatttggagaagtt
caattggtaaggcataaatccaccaggaaggtatatgctatgaagcttctcagcaaattt
gaaatgattaagagatccgattctgcttttttctgggaagaaagggacatcatggctttt
gctaacagtccttgggttgttcagcttttttatgcattccaagatgatcgttacctctac
atggtgatggaatacatgcctggtggagatcttgtaaacttgatgagcaactatgatgtc
cctgaaaaatgggcacgattctatactgcagaagtagttcttgcattggacgcaatccat
tctatgggtttcattcatagagatgtgaagcctgataacatgctgctggataaatctgga
catttgaagttagcagattttggtacttgtatgaagatgaataaggaaggtatggtacga
tgtgatacggcagttggaacacctgattatatttcccctgaagtattaaaatctcaaggt
ggtgatggttattatggacgagaatgtgactggtggtcagttggggtatttttatatgaa
atgcttgtaggtgatacacctttttatgcagattctttggttggaacttatagtaaaatt
atgaaccataaaaattcacttaccttccctgatgataatgacatatcaaaagaagctaaa
aatcttatttgtgccttccttactgacagagaggtgagattaggacgaaatggtgtagaa
gaaatcaaacgacatctcttcttcaaaaatgatcagtgggcttgggaaacactcagagac
actgtagcaccagttgtacctgatttaagtagtgacattgatacaagtaattttgatgac
ttggaagaagataaaggagatgaagaaacattccccatacctaaagcttttgttggcaat
caactaccttttgtaggatttacatattatagcaatcgtagatacgtatcttcagcaaat
cctaatgataatagaactagctccaatgcagataaaagcttgcaggaaagtttgcaaaaa
acaatttataagctggaagaacagctgcataatgaaatacaattaaaagatgaaatggag
cagaagtgcagaacttcaaacataaaactagacaagataatgaaagaattggatgaagag
gggaatcaaagaagaaatctagaatctacagtgtctcagattgagaaagaaaaaatgttg
ctacagcatagaattaatgagtaccaaagaaaagcagaacaggaaaatgagaagaggaga
aatgtagaaaatgaagtttctacattaaaagaccagttggaagacttaaagaaagtaagt
cagaattcacagcttgctagtgagaagttggcacagttacaaaagcagctagaagaagcc
aatgacttactaaggacagaatcagatacagctgtaagattaaggaagagtcacacagag
atgagcaagtcaattagtcagctagagtccctgaacagagaattgcaagagagaaataga
gttctagagaattccaagacacaaacagacaaggagtattaccagctgcaagctgccttt
gaagctgaacgaagagacagaggtcatgattctgagatgattggagaccttcaagctcga
attacatctttacaagaggaggtgaagcatctcaaatataatctcgaaagagtagaagga
gaaagaaaagaggctcaagacatgcttaatcattcagaaaaggaaaagaataatttagag
atagatttaaactacaagctaaaatcattacaacaacggttagaacaagaggtaaatgaa
cataaagtaaccaaagctcgtttaactgacaaacatcaatctattgaagaggcaaagtcc
gttgcaatgtatgagatggaaaaaaagctgaaggaagagagagaagctcgagagaaggct
gaaaatagggttgttcagattgagaaacagtgttccatgctagatgttgatctgaaacaa
tctcagcagaagcttgagcatttgactgaaaataaagaaaggatggaggatgaagttaag
aatcttaccttgcaattggaacaagaatcaaataagcgactgttgttacaaaacgaattg
aagactcaagcatttgaggcagacaatttaaaaggtcaagagaagcagatgaaacaggaa
ataaatactttattggaagcaaagagattattagaatttgagttagctcagcttacaaaa
caatatagaggaaatgaaggacagatgcgggaactacaagatcaacttgaagctgagcaa
tatttctcgacactttataaaacccaggtaaaggaacttaaggaagaaattgaagaaaaa
aacagagaaaattttaagaaaatacaggaactacaaaatgagaaagaaactctttctact
cagttggatctagcagaaacaaaagctgagtctgagcagttggctcgagggcttttagaa
gaacagtactttgaattgacccaagaaagcaagaaagctgcttctagaaatagacaagag
attacagataaagatcatgctgttagtcggcttgaagaaacgaacagcatgctaaccaaa
gatattgaattattaagaaaagaaagtgaagagctaactgataaaatgaggaaagcagaa
gaagaatataagttgaagaaggaggaggagatcagtaatcttaaggctgcctttgaaaag
aacatcaatacagaacgaacccttaaaacacaggctgttaataagttggcagaaataatg
aatcgaaaagattttaaaattgatagaaagaaagctaatacacaggatttgagaaagaaa
gaaaaggaaaatcgaaagctacaactggaacttaaccaagaaagagagaaattcaaccag
atggtagtgaaacatcaaaaggaactaaatgacatgcaagcgcaattggtagaagaatgt
acacataggaatgagcttcagatgcagttggctagcaaagagagtgatattgagcaattg
cgtgctaaacttttggacctttcggattctacaagtgttgctagttttcctagtgctgat
gaaactgatggaaaccttccagagtcaagaattgaaggttggctttcaataccaaataga
ggaaatatcaaacgatatggctggaagaagcagtatgttgtggtaagcagcaaaaaaatt
ttgttttataacgatgaacaagataaggagcaatccaatccatccatggttttggacata
gataaattgtttcatgttcgacctgtaacccaaggagatgtgtatagagcagaaactgaa
gaaattcctaaaatattccagatactatatgcaaatgaaggtgaatgtagaaaagatgta
gagatggaaccagtacaacaagctgaaaaaactaattttcaaaatcacaaagggcatgag
ttcatccctacactctaccactttcctgccaactgtgaggcctgtgccaaacctctctgg
catgtttttaagccaccccctgccctagaatgtcgaagatgccatgttaagtgccacaga
gatcacttagataaaaaagaggacttaatttctccttgtaaagtaagttacgatgtaaca
tcagcaagagatatgctgttgttagcatgttctcaggatgaacaaaaaaaatgggtaact
catttagtaaagaagatacctaagaatccaccatctggttttgttcgtgcatcccctcga
acactttctacaagatccactgcaaatcagtctttccggaaagtggtcaaaaatacagct
ggaaaaactagttaa

DBGET integrated database retrieval system