KEGG   Hipposideros armiger (great roundleaf bat): 109388871
Entry
109388871         CDS       T04661                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04080  Neuroactive ligand-receptor interaction
hai04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109388871 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109388871 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109388871
NCBI-ProteinID: XP_019509462
Position
Un
AA seq 77 aa
MNLRLCVLALLLLWLSLTAVCGGPLLQPSAGKGLEESNTRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgctagcgctcctgctgctgtggctctcgctgaccgcggtg
tgtggagggcccctgctgcagccttctgccgggaaggggctggaggaaagcaatacacgc
cacctggtgcagcctagagggtcaagaaatggaccaggaccctggcagggaggtcggagg
aaattccgccgccagcggccgcgcctttcccataagggccccatgcctttctga

DBGET integrated database retrieval system