KEGG   Hipposideros armiger (great roundleaf bat): 109389714Help
Entry
109389714         CDS       T04661                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109389714 (DOCK7)
Membrane trafficking [BR:hai04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109389714 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 TEA Elong_Iki1
Motif
Other DBs
NCBI-GeneID: 109389714
NCBI-ProteinID: XP_019511041
Position
Un
AA seq 1526 aa AA seqDB search
MGRIRAMPCRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQNTPLETPVGYTWIPM
LQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNVEVVAVSSIHTQD
PYLDKFFALVNALDEHMFPVRIGDMRIMENNLENELKSSISALNSSQLEPVVRFLHLLLD
KLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHGRNSLLASYIYYVFR
LPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNSNPDISGTPTSPDDE
VRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQAMDRSCNRMSSHTETSSFLQT
LTGRLPTKKLFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMVHHLYFNDKLDAPRK
SRFPERFMDDINALVSTIASDIVSRFQKDTEMVERLNTSLAFFLNDLLSVMDRGFVFSLI
KTYYKQVSSKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSA
TSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVIN
MVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFTETHNQRGRPICIAT
DDYESESGSMINQTVAMAIAGTSVPQLTRPGSFLLASTSGRQYTTFSAESSRSLLICLLW
VLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRA
KLEEAILGSIGARQEMVRRSRGQLGTYTIPSPSERSPSGSAFGSQENLRWRKDMTHWRQN
TEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLKVLLHS
MACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIRSHASA
SLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELR
ETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNM
AGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDD
VVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKL
STIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEIS
HRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDK
NYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIE
VAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKL
FRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIP
QLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 4581 nt NT seq  +upstreamnt  +downstreamnt
atggggaggattcgagcaatgccatgccggtctcctgattttcatgaagaaatcaaggtt
aaactccctgctactttaactgaccaccatcatttgctttttactttttatcatgttagt
tgtcaacaaaagcaaaatacccctcttgaaactcctgttggatatacatggataccaatg
cttcaaaatggacgattaaagactgggcagttttgcctaccagtctcgctggaaaagcca
ccgcaggcttattctgtgctgtctcctgaggttcctctacctggcatgaaatgggtagat
aatcacaaaggtgtttttaatgtggaagttgttgctgtttcatctatccatacacaagat
ccttaccttgacaagttttttgctctggtcaatgctctggatgaacacatgttcccggtc
cgaattggagacatgcgaatcatggaaaataacttagaaaatgaattgaagagcagcatt
tcagcattgaattcttctcagttggaaccagtggtccgatttcttcatcttctgcttgat
aaactaatacttttagttgttagacctcctgtcattgctggccaaatagttaatctaggt
caagcatcttttgaagccatggcatcgattataaatcggcttcacaaaaacttggaagga
aatcatgaccagcatggcaggaacagccttcttgcatcatatatctattatgtttttcgc
cttccaaatacttaccctaattcaccatcaccaggtcctgggggtttgggaggatcagtg
cattatgccacaatggctagatctgctgtgagacctgcaagccttaatttaaatcgttct
cggagccttagcaatagtaatccagatatatctgggactcccacgtcaccagatgatgaa
gtacggtcaatcatcggcagtaagggtttagatcgctccaattcctgggttaacactggt
ggtccaaaagctgccccatggggatccaaccccagtccaagtgcagaatcaacacaggct
atggatcgaagttgtaatcgtatgtcttcgcacacagagacgtcaagtttcttacaaaca
ttaacgggacgcttaccaactaaaaagctttttcatgaggagctggctttgcagtgggtt
gtttgcagtggcagcgttcgggaatcagctttgcaacaagcctggttcttttttgagtta
atggtgaagagcatggtgcaccatttatacttcaatgataaacttgatgcaccaaggaaa
agtcgttttccagaacgtttcatggacgacattaatgctcttgtcagtacaattgctagt
gatatagtttcacgatttcagaaggacacagaaatggttgagagactcaacaccagtctt
gcattctttctcaatgatctgttgtctgttatggacagaggatttgtttttagccttata
aagacctactataaacaggtatcttcaaagctttattcattaccaaatccaagtgtcctg
gtgtccttgaggttggattttttgcgaatcatctgcagccatgaacattatgttacatta
aacttaccctgcagcctgctaactccacctgcatcaccatcaccttctgtttcttctgca
acatctcagagttctggattttccaccaatgtacaagaccagaagatcgcaaatatgttt
gaattgtctgtgcctttccgccaacagcattatttggcaggacttgtgttgacagagctg
gctgttattttagaccctgatgctgaaggactgtttggattgcataagaaagtcatcaat
atggtacacaatttactatccagtcatgactcagacccacggtactctgacccccagata
aaggctcgagtggccatgttgtatctacctctgattggtattatcatggaaactgttcct
cagctgtatgattttacagaaactcacaatcaacgaggaagaccaatttgtatagccact
gatgattatgaaagtgagagcggaagcatgataaaccagacggttgccatggcaattgca
ggaacatcagttcctcaactaacaaggccaggcagtttcctcctggcatcaacgagtggc
aggcaatacactaccttttcagcagaatcaagtcggagccttttgatctgtctactttgg
gttctcaagaatgcagatgagacggttctacagaagtggtttacagatctctcagtcctg
cagctaaaccggctattagatctgctctatctctgtgtatcttgctttgaatacaaagga
aagaaagtgtttgaaagaatgaatagtttgacctttaagaaatcaaaagatatgagagca
aagcttgaagaagccattcttgggagcataggcgctaggcaagaaatggtgcgccgaagc
cgaggacagcttggtacgtacacaataccttctccttctgagagaagcccatctgggagt
gcgtttggaagtcaagaaaatctgaggtggagaaaggatatgactcattggcgccaaaac
actgagaagcttgacaaatcaagagcagagattgaacacgaagcactgattgatggaaat
ctggctactgaagcaaacctaatcattttggatacattagagattgttgtccagacagtt
tctgtaacagaatccaaagagagcatccttggtggggtgctaaaagtgctactacatagc
atggcctgtaaccaaagtgcagtttatctacaacactgttttgctacacagagagctctg
gtttcaaagttccctgaactcctgtttgaagaagagacagagcagtgtgctgatttatgc
ctccggctcctccgacactgtagcagtagcatcagcacaatacggtcacatgctagtgcc
tccctttacctactgatgagacaaaactttgaaattgggaataactttgccagggtgaaa
atgcaggtaaccatgtcactatcttccttggtgggcacgtctcagaattttaatgaggaa
ttcttaagacgttctctaaagactatattgacatatgctgaagaagatctggaattgagg
gaaacaacatttcctgatcaggtccaagatttggttttcaatctccatatgatcctttct
gatactgtcaaaatgaaagaacaccaggaggatcctgaaatgttgattgatctaatgtac
agaattgccaagggctaccagacctctcccgatctgcgactgacctggttgcagaacatg
gctggcaagcactcagaacgcagcaatcatgctgaagccgcgcagtgcctggtccactca
gcagcacttgttgctgaatacttgagcatgttggaggaccggaagtatcttcctgtgggg
tgtgtaacatttcagaatatttcatctaatgttttagaagagtctgctgtctcagatgac
gtggtatctccagatgaagaaggtatctgctctggaaagtactttactgaatcaggactt
gtgggattactggaacaagctgctgcttctttctctatggctggcatgtatgaagcagtt
aatgaggtttataaagtccttattcctattcatgaagctaatcgggatgcaaagaaacta
tccacaattcatggtaaacttcaagaagcattcagcaaaattgttcatcagagtactggc
tgggagcggatgtttggcacatattttcgtgttggtttttatggaaccaagtttggagat
ttggatgaacaggaatttgtttacaaggagcctgccataaccaaacttgcagagatatct
cacagattggagggattttatggagaaagatttggagaagatgttgttgaagtaatcaag
gattctaatcctgtagacaagtgtaaattagatcctaacaaggcatatattcagattacc
tacgtggagccatactttgacacatatgagatgaaggacagaatcacatattttgacaaa
aattacaatcttcgccgtttcatgtactgtacacccttcactttagatgggcgtgcccat
ggagagcttcatgaacaattcaaacggaagaccattctgactacttctcatgcttttcct
tatattaagacaagggtcaatgtcactcacaaagaggagatcatcttaacaccaattgaa
gttgctattgaagacatgcagaaaaagacacaggagttggcatttgcaacacatcaggat
cccgcagatcccaaaatgcttcagatggtactccaggggtctgtaggcacaacagtaaat
caggggcctttggaagttgcccaggttttcctatctgaaatacccagtgacccaaaactc
ttcagacatcataataaactgcgactctgcttcaaagattttactaaaaggtgtgaggat
gccttacgaaaaaataagagcttaattggaccagatcaaaaagagtatcaaagggaactg
gagagaaactatcatcgccttaaagaggcccttcagcctctgataaacagaaagatccct
cagttatacaaggcagtattacctgtcacctgccacagagattccttcagtcgaatgagc
ctgcgcaaaatggatctctaa

DBGET integrated database retrieval system