KEGG   Hipposideros armiger (great roundleaf bat): 109389868Help
Entry
109389868         CDS       T04661                                 

Gene name
HSD3B2
Definition
(RefSeq) hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00140  Steroid hormone biosynthesis
hai01100  Metabolic pathways
hai04913  Ovarian steroidogenesis
hai04925  Aldosterone synthesis and secretion
hai04927  Cortisol synthesis and secretion
hai04934  Cushing syndrome
Module
hai_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
hai_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    109389868 (HSD3B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    109389868 (HSD3B2)
   04925 Aldosterone synthesis and secretion
    109389868 (HSD3B2)
   04927 Cortisol synthesis and secretion
    109389868 (HSD3B2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109389868 (HSD3B2)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     109389868 (HSD3B2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     109389868 (HSD3B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 109389868
NCBI-ProteinID: XP_019511348
Position
Un
AA seq 380 aa AA seqDB search
MSGTSILVSTVTIPPIIPAFDDANKSVGSSYIPADGSLTVLLPLSPSPIRTRACQELQSK
VKLTLLEGDILDEQCLKRACQGTSAVIHAAAVIDVFNVIPKETIMNVNLKGTQILLEACA
QASVPIFIYTSTIEVAGPNSYTEAVRNGCEEEHLETVWSAPYPYSKKLAEKAVLAANGWA
LRNGGTLYTCALRPPYIYGEGSPLLYGFIDHALKNNGVLTHNSKLSVVNPAYVGNVAWGH
ILALRALRDPKKAPNVQGQFYYISDDTPHQSYDHLNYTLSKEWGFSLDPSMSLPVSLKYW
LGFLLEILSFLLSPVYQYQPPFTRHLVTLLNSVFTVSYKKAQRELGYEPLFSWEKAKQKT
TEWIGSLVEQHEETLKTKSH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaacctccatactagtttccacagtgacaatccccccaataatacctgctttt
gatgatgctaataagagcgtgggctcatcctacatccctgccgatggctctctgactgtt
cttcttcctctcagcccatctccaataaggaccagagcctgtcaagagctccagagcaag
gtcaagctgaccttgctggaaggagacatcctggatgaacagtgcttgaagcgagcctgc
cagggcacctcggctgtcattcatgccgccgctgtcatcgatgtcttcaatgtcattcca
aaagagaccatcatgaatgtcaatctgaaaggtacccagatcctgctggaggcctgtgcc
caggctagcgtgcccatcttcatttataccagcaccatagaggtggctgggcccaactcc
tacacggaggccgtccggaatggctgcgaagaagagcatctggaaacggtgtggtcggct
ccctacccatacagcaaaaagctcgctgagaaggccgtgctggcagcgaatgggtgggct
cttagaaacggtggcaccttgtacacgtgcgccttaaggcccccgtatatctacggggaa
ggcagccccctgctctatggctttattgaccacgccctgaagaacaacggcgtcctgaca
cataacagcaagctgtccgtggtcaaccccgcctacgtcggcaacgtggcttggggccac
attctagctttgagggccctgcgggaccccaagaaggccccaaacgtccaaggacagttt
tactacatctccgatgacacacctcaccaaagctatgatcacctcaactacactttgagc
aaagaatggggcttctccctcgaccccagcatgagccttcccgtatctctgaagtactgg
ctcggcttcctgctggaaatcctgagcttcctgctcagcccagtttaccaataccagccg
cccttcacccgccacttggtgacattgttgaatagtgtgttcaccgtctcctataagaaa
gctcagcgagagctgggctacgagcccctcttcagctgggagaaagccaagcagaaaacc
acggagtggattggctccctggtggaacagcacgaggagaccctgaaaacaaagagtcac
tga

DBGET integrated database retrieval system