KEGG   Hipposideros armiger (great roundleaf bat): 109391258Help
Entry
109391258         CDS       T04661                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00561  Glycerolipid metabolism
hai01100  Metabolic pathways
hai04714  Thermogenesis
hai04723  Retrograde endocannabinoid signaling
hai04923  Regulation of lipolysis in adipocytes
Module
hai_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    109391258 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109391258 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109391258 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    109391258 (MGLL)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109391258 (MGLL)
Peptidases [BR:hai01002]
 Serine Peptidases
  Family S33
   109391258 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_3 LIDHydrolase DLH Abhydrolase_5 Thioesterase PGAP1 Abhydrolase_2 Ser_hydrolase DUF1350 DUF2974
Motif
Other DBs
NCBI-GeneID: 109391258
NCBI-ProteinID: XP_019514205
Position
Un
AA seq 337 aa AA seqDB search
MMETGLGDPFKMPEESSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPEGTPKALVFVSH
GAGEHCGRYDELAKMLVGLELLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDTVQK
DYPGLPVFLLGHSMGGAIAILTAAEKPGHFSGMVLISPLVLANPESATTFKDYPKNLLKM
ASRMVLPWIPHSVWVLAAKVLNLVLPNMSLGPIDASVLSRNKTEVDLYITDPLICRAGLK
VCFGIQLLNAVSRVERALPKLTLPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEG
AYHVLHKELPEVTNSVFHEINMWISQRTAAARTGSPP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaacaggacttggagatcctttcaaaatgccggaagaaagttctcccaggcga
acgccgcagaacgttccataccaggacctccctcacttggtcaatgccgacggacagtac
ctcttctgtaggtactggaaacctgagggcactcccaaggcccttgtttttgtgtcccat
ggagctggggagcactgcggtcgctatgatgagctggctaagatgctggtggggctggaa
ctgctggtgttcgctcatgaccatgttggccatggacagagcgaaggggagaggatggta
gtgtccgacttccacgttttcatcagggatgtgttacagcacgtggatactgtgcagaaa
gactacccggggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatc
ctcacagccgcagagaagccaggccacttttccggcatggttctcatttcacctttggtt
ctggccaatcctgagtccgcaacaactttcaaggattatccgaagaacttgctcaaaatg
gcatcaagaatggtactaccttggattccacattctgtatgggttcttgctgcaaaagtt
ctcaaccttgtcctgccaaacatgtccctgggcccgatcgatgccagcgtgctctctcgg
aataagacggaggtggatctttacatcacagaccccctcatctgcagggcaggactgaaa
gtgtgctttggcatccagctgctcaatgctgtctcgcgggtcgagcgggccctccccaag
ctgaccttgcccttcctgctgctccagggctctgctgaccgcctgtgcgacagcaaaggg
gcctatttgctcatggagtctgccaagagccaggacaagacactcaagatttacgaaggt
gcctaccatgttctccacaaagagcttcctgaagtaaccaactctgtcttccatgaaata
aacatgtggatctctcaaaggacagcggcagcgagaacagggtccccgccctga

DBGET integrated database retrieval system