KEGG   Hipposideros armiger (great roundleaf bat): 109391652Help
Entry
109391652         CDS       T04661                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109391652 (DOCK6)
Membrane trafficking [BR:hai04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109391652 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 109391652
NCBI-ProteinID: XP_019514936
Position
Un
AA seq 2112 aa AA seqDB search
MAAAERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVIEPLDFEDVL
LSRPPDAEPGPLRDLVEFPADDLELLLQPRECRTTEPGMPEDGKLDSQVRAAVEMYTEDW
IIAHRRYQHLSAAYSPITTETQRERQKGLTRQVYEQDASGDEKSSPEDSDDPRHSSGSPE
DTPRSSGASGIFDLRNLAADSLLPSLLERAAPEDVDRRNEALRRQHRPRTLLSLYPAPDE
DEAVERCSRPEPPHEHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDL
NSDSTKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMV
MKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQPDRDSDSEGE
RRPAWTDRRRRGPPDRTSSGDDACSLSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YAPHTSYRNLLYVYPHSLNFSSRQGSVRNLTVRVQYMAGEDPSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIP
LLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQ
DSHLDKFFTLVHVLEEGAFPFRLKDGVLSEGTVEQELRASLAALRLTSPEPLVAFSHHVL
DKLVRLVVRPPVIGGQIVNLGRGAFEAMAHVVSVVHRSLESAQDARGHCPLLAAYVYYAF
RVPGTEPSLPGGALPVTVQPATLARGPGRPASLYLARSKSISSSNPDLAVALGSVDDEVS
RILASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQTIDRSFNRTSYLESSSSAP
AATQPRPTVQKLLHEELALQWVVSGSAVREAVLQHAWFFFQLMVKSMALHLILGQRLDTP
RKIRFPGRFLDDIAALVGSVGMEVITRVYKDAELAERLNASLAFFLSDLLSLADRGFVFS
LVRAHYKQVASRLQSAPNPAVLLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSVS
STTSQSSTFSSQAPDSKVTSMFELSGPFRQQHFLAGLLLAELALALEPEAEGASLLHKKA
ISAVHSLLSGHDADPRYAEATVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASM
LDSDTEGEGDIGGTINPSVAMAIAGGPLAPGSRGSISQGPAAGSRSGCPLSAESSRTLLV
CVLWVLKNAEPALLQHWAADLSPPQLGRLLDLLYLCLAAFEYKGKKAFEHINSLTFKKSL
DMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSITHWRQTSDRVDKTKEEME
HEALVDGNLATEASLVVLDTLEIIVQTVMLSEARESVLGAVLKVVLYSLGSAQSALFLQH
GLATQRALVSKFPELLFEEETELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFEI
GNNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRDSNFAEQVQDLM
FNLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAE
AAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSG
KHFTELGLVGLLEQAAAYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFT
KIMHQSSGWERVFGTYFRVGFYGARFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFG
EDVVEIIKDSNPVDKTKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCTP
FTPDGRAHGELHEQHKRKTLLSTDHAFPYIKTRIHVCHREETVLTPVEVAIEDMQKKTRE
LAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFK
DFCKKCEDALRKNKALIGPDQKEYHRELERNYTRLRESLQPLLTQRLPQLLAPTTASLRN
SLNRASFRRPDL
NT seq 6339 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgagcgccgcgccttcgcgcacaagatcaacaggacggtggctgccgag
gtgcggaagcaggtgtcccgggaacgcagtggctccccccattccagcaggcgctgcagc
agctccctgggggtcccactgactgaagtcattgagcccttggactttgaagacgtgctg
ctaagccggccgccagatgctgagcctgggcccctccgggacctggttgagtttccagct
gatgacctagaactgctgctgcagccccgggaatgccggaccacggagcctgggatgccc
gaggatgggaagctggactcccaggtgagggctgcggttgagatgtacacagaggactgg
atcattgcccacagaaggtaccagcatctgagtgcagcatacagtcccatcaccacagag
acccagagagagcggcagaagggcctcactcgccaggtctatgagcaggatgcttctggg
gatgagaagtccagcccagaggactcggatgacccccggcactcctcgggctccccagag
gacactccgcgaagcagtggcgcctctggcatctttgacctgaggaacttggcagctgac
tcactgctgccctcacttctggagcgcgcagctcccgaggacgtggaccggcgcaatgag
gccctgcggcggcagcaccggccccgcaccctgctctcgctctacccagcgcctgacgag
gatgaggctgtggaacgctgcagccgcccggagccgccccatgaacacttcggacagagg
atcctggtcaagtgtctgtcacttaagttcgagatcgagattgagcccatctttggcatc
ttggccctgtatgatgtgcgggagaaaaagaagatctcggagaacttctactttgaccta
aactcagactccacgaaggggctgctgcgagcccatggcactcacccggccatctccacc
ctggcccgctctgccatcttctccgtgacctacccctcacctgacatcttcctggtcatc
aagctggagaaggtgctacagcaaggggacatcagcgaatgctgtgagccctacatggtg
atgaaggaggtggacacagccaagaacaaagagaagctggagaagctgcgcctggcagcg
gagcagttctgcacccgcctgggccgctaccgcatgcccttcgcctggaccgccgtacac
ttggccaacatcgtgagcagcgcagggcagccagatcgggactcggactctgagggcgag
cgtagacccgcctggaccgaccgccgccgtcgtgggcccccggatcggacaagtagtggg
gacgacgcctgcagtctctctggcttccgcccagccacactaactgtcaccaacttcttt
aagcaggaagcagagcggctcagtgacgaggacctcttcaagttcctcgctgacatgcgg
cgcccgtcgtctttgctacggcgtctaaggcctgtgacggcccagctgaagatcgacatc
tccccggcccccgagaacccccacttctgcttgtccccggaactgcttcatgtcaagcct
tacccagaccccaggggccggcccaccaaggagatcctggagttccctgcccgtgaggtc
tacgcaccccacaccagctacaggaatctgctctacgtgtacccacacagcctcaacttc
agcagccgccagggctccgtgcgtaacctcactgtccgagtgcagtacatggcaggcgag
gaccccagccaggccctgccggtcatctttggcaagtccagctgcagtgaattcacccgt
gaggccttcacaccggtggtctaccacaacaagtcccctgagttctatgaagagttcaag
ctgcgtcttccagcctgtgtgaccgagaaccaccacctgctcttcaccttctaccacgtc
agctgccagccccggcccggcacggccctggagactcctgtgggctttacttggatccca
ctgctgcagcacggccgcctgaggacaggccccttctgcctgcctgtgtccgtggaccag
cctccgcccagctactctgtgctcacacctgacgtggcgctgccgggcatgcggtgggta
gacggccataagggcgtgttcagcgtggagctcacagctgtgtcctctgtgcatccccag
gattcacacctggacaagttcttcaccctggtgcatgtcctggaggagggggccttccca
ttccggctcaaggacggtgtgctgagcgagggtactgtggagcaggagctgcgggcaagc
ttggcagccctgcgcctcaccagcccagagcctctcgtcgccttctctcaccatgtgctg
gacaagctcgtacgtctggtcgtgcggcccccggtcatcggcggccaaatagtgaacctg
ggtcgtggagcctttgaagcaatggcccatgtggtcagcgtcgtccatcggagcctggag
tctgcccaggatgcccgtggtcactgcccactgctggctgcctatgtctactatgccttc
cgagtgcctggcactgagcccagcctcccaggtggggcccttccagtgacagtgcagcct
gccacactggcccgtggccctggccgccctgcaagcctctacctggctcgctctaagagc
attagcagcagcaaccctgacttggccgtggcccttggctctgtggatgatgaggtctcc
cgcattctggccagcaagggtatcgaccgctcacactcctgggtgaattctgcttatgct
ccaggaggcagcaaggctgtgctgcgacgggcacccccttattgcggggccgaccccaga
cagaccatcgaccgcagctttaaccgaacctcctacctcgagagctcctcctcggcccca
gcagccacccagccaagacccactgtgcagaagcttcttcacgaggagctggctttgcaa
tgggtggtcagtggcagtgccgtgcgtgaagccgtcctgcagcacgcctggttcttcttc
caactcatggtaaaaagcatggcgctgcacctgattctgggccagcgtctcgacacaccc
cgcaagatccgcttccctgggcgcttcctggatgacatagcggccctggtgggctccgta
ggcatggaagtcatcacccgggtctacaaggacgcggagctggccgagcgcctcaatgcc
agcctggccttcttcctcagcgacctgctgtccctggcagaccgtggctttgtcttcagc
ctggttcgggcccactataagcaggtggcctcgcggctacagtcagcccccaaccctgca
gtgctgctgaccctacgtatggacttcacccgcatcctgtgcagccatgagcactacgtg
accctcaacctcccctgctgtcccctgtcacccccggcttcgccgtcaccctcggtatcc
tccacaacctcccagagctccaccttctccagccaggctccagactccaaggtgaccagc
atgttcgagctgagtgggcctttccggcagcagcacttcctggctgggctcctgctggca
gaactggcactggccctggaacctgaggctgagggggcatccctgctgcacaagaaagcc
atcagtgctgtccacagtctgctcagtggccatgacgctgacccccgctatgccgaggcc
accgtgaaggcccgtgtggccgagctgtacctgccactgctgtcacttgcccgggacaca
ctgccacggctacacgactttgctgagggcccaggtcaacggtcaagactggcctcaatg
cttgactcagacacagaaggagaaggggacattggaggaaccatcaacccctcagtggcc
atggccatcgctggtggccccctggcccctggctcccggggcagcatttctcagggccca
gcagcgggttctcgctcaggctgtcccctctctgccgagtccagccggaccttgctggtg
tgtgtgctgtgggtactaaagaatgcagagccagccctgctgcagcactgggctgccgac
ctgtccccgcctcagctgggtcgtctcttggacttgctgtacctctgcctggctgccttt
gagtacaaggggaaaaaggcctttgagcacatcaatagcctcacattcaagaagtccctg
gacatgaaggctcgattggaagaagccatcttgggcaccattggagcacgacaggagatg
gtacgacggagccgtgagaggagcccatttgggaaccaggagaacgtacgctggcggaag
agcatcacacactggagacaaacctcggaccgtgtggataagaccaaggaagaaatggaa
catgaggctttagtggatgggaacctggccaccgaggcgagcctggtggttctggacaca
ctggagatcatcgtgcaaacggtgatgctgtccgaggcccgggagagtgtcttgggtgca
gtactgaaggtcgtgttgtatagtctgggcagtgcccagagtgccctcttcttgcagcat
ggcctggccacacagcgggccctggtatccaagttcccggagctgctgtttgaagaggag
acggagctgtgtgccgacctctgcttgaggctcctgcgacactgcggcagccgtatcagc
accatccgcacgcacgccagtgcctcgctatacctcctcatgcgccagaatttcgagatt
ggcaataactttgcccgcgtgaagatgcaagtgaccatgtcactgtcgtccctagtgggg
acaacgcagaacttcagtgaggaacacctgcgacggtcactcaagaccatcctcacttat
gccgaagaggacgtgggcctgcgggatagcaatttcgccgagcaggtccaggacctgatg
ttcaatctgcatatgatcctgacggacacagtgaagatgaaggagcatcaggaggaccct
gagatgctcattgacctcatgtacaggattgcccggggctaccagggctccccggacctg
cgactgacatggctgcagaacatggcggggaagcacgcagagctaggcaaccacgcagag
gctgcgcagtgcatggtgcacgcggctgcgctggtggcggagtacctcgccctcctcgag
gatagccgtcacctgcccgtgggctgcgtttccttccagaatatctcgtccaacgtgctg
gaggagtctgccatctctgatgacatcctgtcgcctgacgaggagggcttctgctctggg
aagcactttacggagctggggctggtggggctgctggagcaggcggctgcctactttacc
atgggagggctctacgaggcagtgaatgaggtatacaagaccttgatccccatcctggaa
gcccaccgcgactacaagaagctggctgctgtgcacggcaaactgcaggaggccttcacc
aagatcatgcaccagagctctggctgggagcgtgtatttggaacatacttccgtgtgggt
ttctacggtgcccgcttcggtgacctggatgaacaggagtttgtgtacaaggagccatcc
atcacgaagttggctgagatctcacatcggctagaggagttctacacggaaaggtttggg
gaggacgtggttgagattatcaaagattcaaaccccgtggacaagaccaagctcgacccc
cagaaggcttacatccagatcacatacgtggaaccacatttcgatacctatgagctcaag
gaccgcgtgacctacttcgaccgcaactacgggctgcgcacctttctgttctgcacgccc
ttcacacccgatgggcgtgcgcatggggagctgcacgaacaacacaagcgcaagacactg
ctgagcacggaccatgccttcccctacatcaagactcgcatccacgtgtgccaccgggag
gagacagtgttgacgccagtggaagtggctatcgaggacatgcagaagaaaacacgggag
ctggcttttgccaccgagcaggacccacccgatgccaagatgctgcagatggtgctacag
ggctctgtggggcccactgtgaaccagggtcccctggaggtggcccaagtgtttttggcg
gagatcccagaagaccccaagctcttcaggcatcacaacaagctgcgactctgtttcaag
gacttctgcaagaagtgtgaggatgcactgcggaagaacaaggccctgattgggccggac
cagaaggagtaccaccgtgagctggagcgcaattacacccgcctgcgggagtctctgcag
cccctgctcacccagcgcctgccccagctgctggcaccgaccacagccagcctcaggaac
tccttgaacagagcaagtttccggaggcctgacctctga

DBGET integrated database retrieval system