KEGG   Hipposideros armiger (great roundleaf bat): 109391885Help
Entry
109391885         CDS       T04661                                 

Gene name
CAMKK1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    109391885 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109391885 (CAMKK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109391885 (CAMKK1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  CAMKK family
   109391885 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109391885
NCBI-ProteinID: XP_019515369
Position
Un
AA seq 507 aa AA seqDB search
MAMEGGPAVCCQDPRAELVERVAAIDVAHLEEADGGPGPARNGVDPPPRARAASMIPGCA
SRLPLGRPSLSARKFSLQERSAASCLEAQAGPYATGPASHISPRTWRRPTIESHHVAISD
AEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRG
SQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPV
MEVPCDKPFPEEQARLYLRDIILGLEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSN
QFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFIYGKCPFIDEYI
LALHKKIKNEAVVFPDEPKVSEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEDPLP
SEEEHCSVVEVTEEEVKNSVKLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSVSAPG
NLLLKDGCGEGIKSPELPGVQEDEAAS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggccatggaggggggcccagcagtctgctgccaggaccctcgggcagagttggtggaa
cgagtggccgccatcgatgtggcccacttggaggaggcggatggtggcccagggcctgcc
aggaatggtgtggaccctccaccacgggccagagctgcttccatgatccctggctgtgct
tcaagactccccctaggtcgtcctagcctctcagctaggaagttttccctgcaggagcgg
tcagcagcaagctgcttggaggcccaggctgggccttatgccacaggacctgccagccat
atctccccacggacctggcggaggcccaccatcgagtcccaccatgtggccatctcagat
gcagaggattgtgtgcagctgaaccagtacaagctgcagagtgaaattggcaagggtgcc
tacggcgtggtgagactggcctataatgaaagtgaagacaggcactacgcaatgaaagtt
ctttccaaaaagaagttactgaagcagtatggctttccacgccgccctcccccaagaggg
tcccaggctgcacaaggaggaccagccaagcagctgctacccctggagcgggtgtaccag
gagatcgccatcctgaagaagctggaccacgtgaatgtggtcaagctgatcgaggtcctg
gatgacccagctgaggacaatctctatttagtgtttgacctcctgagaaaggggccggtc
atggaggtgccttgcgacaagccctttccggaggagcaagctcgcctctacctgcgggac
atcatcctgggacttgagtacttgcactaccagaagatcatccacagggacatcaagcca
tccaacttgctcctgggggacgacgggcacgtgaagattgccgacttcggcgtcagcaac
cagtttgagggaaacgatgctcagctgtccagcacggccgggaccccagcattcatggcc
cctgaggccatttctgattctggccagagcttcagcgggaaggccttggatgtgtgggcc
actggggtcacgttgtactgcttcatctatgggaagtgcccattcattgacgagtacatc
ctggccctgcacaagaagatcaagaacgaggccgtggtgtttcccgacgagccaaaggtc
agtgaggagctcaaggacctaattctgaagatgctagacaagaatccagaaacaagaatt
ggggtgccagacatcaagctgcacccctgggtgaccaagaatggggaggatccccttccc
tcggaggaggagcactgcagcgtggtggaagtgactgaggaggaggtgaagaactctgtc
aagctcatccccagctggaccacagtgatcctggttaagtccatgctgaggaagcgttcc
tttgggaacccgtttgagccacaagcacggagggaagagcgatccgtgtctgctccagga
aacctactgttgaaagatgggtgtggtgaagggatcaagagcccggagctccccggagtc
caagaagatgaggctgcgtcctga

DBGET integrated database retrieval system