KEGG   Hipposideros armiger (great roundleaf bat): 109392646Help
Entry
109392646         CDS       T04661                                 

Gene name
PHF6
Definition
(RefSeq) PHD finger protein 6
  KO
K23310  PHD finger protein 6
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109392646 (PHF6)
   03009 Ribosome biogenesis [BR:hai03009]
    109392646 (PHF6)
   03036 Chromosome and associated proteins [BR:hai03036]
    109392646 (PHF6)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    109392646 (PHF6)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   109392646 (PHF6)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    109392646 (PHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 109392646
NCBI-ProteinID: XP_019516782
Position
Un
AA seq 366 aa AA seqDB search
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPS
QGIYMVYCRKHKKTAHNSEAADLEESFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDT
RSTSSHGTDEMESSSYRDRSPHRSSPSDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAH
YKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVK
TYHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKLEIDQQQLTQ
QQLNGN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagctcagttgaacagaaaaaagggcctacaagacagcgcaaatgtggcttttgt
aagtcaaatagagacaaggaatgtggacagttactaatatctgaaaaccagaaggtggca
gcacaccataagtgcatgctcttttcgtctgctttggtatcatcacactctgataacgaa
agtcttggtggattttctattgaagatgtccaaaaggaaattaaaagaggcacgaaactg
atgtgttctttgtgccattgtcctggagcaacaattggttgtgatgtgaaaacatgtcac
aggacataccactaccactgtgcattgcatgataaagctcaaatacgagagaaaccttca
caaggaatttacatggtttattgccggaaacacaagaaaactgcacataactctgaagca
gctgatttagaagaaagttttaatgaacatgaactggagccctcatcacctaaaagtaaa
aagaaaagccgcaaaggaaggccacgaaaaactaattttaaagggctgtcggaagatacc
aggtccacatcctcccatggaacagatgaaatggaaagtagttcctatagagataggtct
ccacatagaagcagccctagtgacaccaggcctaaatgtggattttgtcacgtaggggag
gaggaaaatgaagcaagaggaaagctgcatatatttaatgccaaaaaggcagctgcacat
tataagtgcatgttattttcttctggcacagtccagctcacaacaacatcaagagcagaa
tttggagattttgatattaaaactgtacttcaggagattaagcgaggaaaaagaatgaaa
tgtacactttgcagtcagcccggtgctactattggatgtgaaataaaagcctgtgttaag
acttaccattaccactgtggagtacaagacaaagctaaatacattgaaaatatgtcacga
ggaatttacaaactatattgtaaaaatcatagtggaaatgatgagagagatgaagaagat
gaggaacgagagagtaaaagccggggaaaattagaaattgatcagcaacaactaactcag
cagcaacttaatggaaactag

DBGET integrated database retrieval system