KEGG   Hipposideros armiger (great roundleaf bat): 109393261
Entry
109393261         CDS       T04661                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109393261 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109393261 (ASIC1)
Ion channels [BR:hai04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   109393261 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 109393261
NCBI-ProteinID: XP_019517855
Position
Un
AA seq 557 aa
MLLIRAPHFKNHCSIIAVEKLHPRRIPLARMELKAEEEEVGGVQPVSIQAFASSSTLHGL
AHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFNYHHVTKLDEVAASQLTFPAV
TLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPK
PFNMREFYDRAGHDIRDMLLSCQFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM
KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQ
TFVSCQEQRQLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHMP
GDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLA
KKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVL
ELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAA
NILPHHPARGTFEDFTC
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgctactgatccgggcaccacacttcaagaaccactgctctatcatagctgttgaaaaa
ctacatccaagaaggatacccttggccaggatggaactgaaggctgaggaggaggaggtg
ggtggcgtccagccagtgagcatccaggccttcgccagcagctccacgctgcacggcctg
gcccacatcttctcttacgagcggctgtcactgaagcgggcgctctgggccctgtgcttc
ctgggctcgctggctgtgctgctgtgtgtgtgcaccgagcgtgtgcagtactacttcaac
taccaccacgtcaccaagcttgatgaggtggctgcctcccagctcactttcccggccgtc
acgctgtgcaacctcaacgagttccgctttagccaagtctccaagaatgacctgtaccat
gctggggagctgctggccctgctcaacaacaggtatgagatacccgacacacagatggca
gatgaaaagcagctggagatattgcaggacaaggccaacttccgcagcttcaagcccaag
cccttcaacatgcgcgagttctacgaccgcgcggggcatgacattcgagacatgctgctc
tcctgccagttccggggggaggtctgcagcgcagaagacttcaaggtggtcttcacacgg
tatggaaagtgctacacattcaactcaggccgagatgggcgtccacggctgaagaccatg
aagggtgggacgggcaatgggctggagatcatgctagacatccagcaggacgagtacctt
cccgtatggggggagactgatgagacgtcctttgaagcaggcatcaaagtgcagatccac
agtcaggacgaacctcccttcatcgaccagctgggctttggtgtggccccagggttccag
acctttgtgtcctgccaggagcagcggcagctcatctacttgcccccgccctggggcacc
tgcaaagctgttaccatggactcggatttcttcgactcctacagcattaccgcctgccgc
attgactgtgagacccgctacctggtggagaactgtaactgccgcatggtgcacatgcca
ggggacgccccatactgcacgccagagcagtacaaggagtgtgcagatcctgctctggac
ttcctggtggaaaaggaccaggagtactgtgtgtgtgaaatgccctgcaatctgacccgc
tatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaagtacctggca
aagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggacattttc
tttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagattgcagggctc
ctgggtgacattgggggccagatggggctgttcatcggggccagcatcctcacagtgctg
gagctctttgattatgcttatgaggtcattaagcacaagctgtgcagacgagggaagtgc
cagaaggaggccaaaaggagcagcgcggacaagggcgtggccctcagcctggatgacgtc
aaaagacacaacccgtgtgagagcctccggggccatcctgcggggatgacgtacgctgcc
aacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system