KEGG   Hipposideros armiger (great roundleaf bat): 109393593
Entry
109393593         CDS       T04661                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00230  Purine metabolism
hai01100  Metabolic pathways
hai01522  Endocrine resistance
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04114  Oocyte meiosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04371  Apelin signaling pathway
hai04540  Gap junction
hai04611  Platelet activation
hai04713  Circadian entrainment
hai04714  Thermogenesis
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04727  GABAergic synapse
hai04742  Taste transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04913  Ovarian steroidogenesis
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04918  Thyroid hormone synthesis
hai04921  Oxytocin signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04925  Aldosterone synthesis and secretion
hai04926  Relaxin signaling pathway
hai04927  Cortisol synthesis and secretion
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai04972  Pancreatic secretion
hai04976  Bile secretion
hai05032  Morphine addiction
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05200  Pathways in cancer
hai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109393593 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109393593 (ADCY4)
   04371 Apelin signaling pathway
    109393593 (ADCY4)
   04020 Calcium signaling pathway
    109393593 (ADCY4)
   04072 Phospholipase D signaling pathway
    109393593 (ADCY4)
   04024 cAMP signaling pathway
    109393593 (ADCY4)
   04022 cGMP-PKG signaling pathway
    109393593 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109393593 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109393593 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109393593 (ADCY4)
   04062 Chemokine signaling pathway
    109393593 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    109393593 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    109393593 (ADCY4)
   04912 GnRH signaling pathway
    109393593 (ADCY4)
   04913 Ovarian steroidogenesis
    109393593 (ADCY4)
   04915 Estrogen signaling pathway
    109393593 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    109393593 (ADCY4)
   04921 Oxytocin signaling pathway
    109393593 (ADCY4)
   04926 Relaxin signaling pathway
    109393593 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    109393593 (ADCY4)
   04918 Thyroid hormone synthesis
    109393593 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    109393593 (ADCY4)
   04916 Melanogenesis
    109393593 (ADCY4)
   04925 Aldosterone synthesis and secretion
    109393593 (ADCY4)
   04927 Cortisol synthesis and secretion
    109393593 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109393593 (ADCY4)
   04270 Vascular smooth muscle contraction
    109393593 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    109393593 (ADCY4)
   04971 Gastric acid secretion
    109393593 (ADCY4)
   04972 Pancreatic secretion
    109393593 (ADCY4)
   04976 Bile secretion
    109393593 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    109393593 (ADCY4)
   04727 GABAergic synapse
    109393593 (ADCY4)
   04725 Cholinergic synapse
    109393593 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    109393593 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    109393593 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    109393593 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    109393593 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    109393593 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109393593 (ADCY4)
   04714 Thermogenesis
    109393593 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109393593 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    109393593 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109393593 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109393593 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109393593 (ADCY4)
   05163 Human cytomegalovirus infection
    109393593 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109393593 (ADCY4)
Enzymes [BR:hai01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109393593 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 109393593
NCBI-ProteinID: XP_019518533
Position
Un
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALLAVAWASGRELASDPG
FLATVLCALVGFSLLLGLASREQRLQRWTRFLSGLVWTALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTTYAMLPLGMRDAAAAGFASSFSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITRATLALLAG
AYAVEDAAMEPRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSTLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSVTFLLFLLLLFVCFSEHLTRCVLKGPKMLHWLPTLSSLVATRP
GLRVTLGTATILLVFSMAITSLFFLPTTSNCPFWASNVSSMAFNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLVARLYLGLLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASIPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRAGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccgcccagcgaagacctcttctatgagacctac
tacagcctgagccagcagtacccgctgctgctactgttgctggtgatcgtgctctgcgcg
ctcctggcgctgctcgctgtcgcctgggccagcggcagggagctggcctcagacccaggc
ttcctggccacggtgctgtgtgcgctggtcggcttctcgttgctgctgggcctggcttct
cgcgagcagcgactgcagcgctggacgcgtttcctgtcaggtctcgtgtggacagcgctg
cttgcgctaggccacggcttcctgttcaccgggggcgtagtgagcgcctgggaccaggtg
tcttttttcctctttgtcatcttcaccacgtacgccatgttgcccttgggcatgcgggac
gccgccgccgcgggcttcgcctcatcattctcacacctgctggtcctcggcctatatctt
gggcctcagccagactcacggcccgcgctgctgccgcagttggcagcaaatgcggtattg
ttcctctgcgggaacgtggcgggagtgtaccacaaggcgctgatggagcgcgcgttgcgc
gccaccttccgagaggctctgagttccctgcactcgcgcaggcggctggatacagagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacgactgcaagctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatcgtg
ggcttcacgcggctcgccagtgaatgctctccaaaggagttggtgctcatgcttaatgag
ctctttggcaagttcgaccagatcgccaaggagcacgaatgtatgcggatcaagattctg
ggagactgttactactgtgtctccgggctgccactctcactgccagatcacgcgatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggt
gtggacatcaacatgcgcgtgggcgtgcactctggcaatgtgctctgcggagtcatcggg
ctgcagaagtggcagtatgatgtctggtcccatgacgtcacactggccaaccacatggag
gcaggcggcgtgccaggaagagtacatatcacaagggctaccctggccctgctggcagga
gcttatgctgtggaggatgcagccatggaaccccgggacccataccttcgagagctaggg
gagcctacttacctggtcatcgatccccgggcagaggaagaggatgagaagggcactgca
ggtgggttgctgtccactcttgaaggccccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagagagccct
gtgtccacctccacccctctcccggagaaggctcttgcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgatgaattggacactggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgacactgtacttccgagagaaggagatggagaaagagtatcgactctccgca
ctccctgcctttaaatactatgcagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctggtaacaaacaggcccccagctctggccatcacctatagcgtcaccttc
ctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacgaggtgtgtcttg
aaaggccccaagatgctgcactggttgcccacactgtccagcctggtggccacacggccc
ggactgcgagtcaccctgggcaccgccaccatcctcctcgtcttttccatggccattacc
agcctgttcttcttaccgacaacatcaaactgccccttctgggcttccaatgtgtcctcc
atggctttcaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgctgggtttcctctcctgctctctctttctgcatatgagcttc
gaactgaagctgctgctgctcctgctgtggctggcggcctcctgctccctcttcctgcac
tcccacgcctggctgtccgactgcctcgttgcccgcctctatctgggccttttggactcc
aggccaggggtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttc
ttcacactccttgtcttggctcggcagaatgagtattattgccgcctggacttcctgtgg
aagaagaaactgagacaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacatgtggccccccagttcattggccagaaccggcgc
aatgaggacctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcaatccca
gacttcaaggagttttattccgaatccaacatcaaccacgaggggctagagtgtctgcgg
ctactcaatgagatcattgctgattttgatgagctgctctctaagcccaagttcagtggg
gtggagaagattaaaaccatcggcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggatgcacagcaggatgctgagcgaagctgtagccaccttggcactatggtg
gagtttgcagtagcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcttacgtgtggggttgaaccatggacctgtagtggccggagtgataggagcccag
aagccacaatatgacatctggggcaacacagtgaatgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaggagacagcccgagccctgcagtccttaggc
tacacctgttacagccggggtatcatcaaggtcaaaggcaaagggcagctgtgcacctac
ttcctgaacacagatttgacacgagctggacctccctcggcaaccctaggctga

DBGET integrated database retrieval system