KEGG   Hipposideros armiger (great roundleaf bat): 109393701
Entry
109393701         CDS       T04661                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00230  Purine metabolism
hai00240  Pyrimidine metabolism
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109393701 (DCK)
   00240 Pyrimidine metabolism
    109393701 (DCK)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109393701 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 109393701
NCBI-ProteinID: XP_019518740
Position
Un
AA seq 260 aa
MATPPKRSCPSPATSSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVVRWCN
VQNAQDEFQELTASQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKVKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGLIYLRA
TPEKCKSRIYLRGREEEQGIPLEYLEKLHYKHESWLLHRTLRTNFSYLQEVPILILDVNE
DFKDKHHSLVERVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagaggagctgcccatctcccgcgaccagctctgagggcacccgc
atcaagaaaatttccattgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaagcaagtctgcgaggattgggaagtggttcctgaacctgttgtcagatggtgcaat
gttcaaaatgctcaagatgaatttcaggaactcacagcatctcagaaaagtggtgggaat
gttcttcagatgatgtacgagaagcctgagcgatggtcttttaccttccagtcatatgcc
tgcctcagtcgcatacgagctcagcttgcttctctcaatggcaaggtgaaagatgcagag
aaaccggtattattttttgaacgatctgtgtatagcgacaggtatatttttgcatctaat
ttgtatgaatctgagtgcatgaatgaaacagagtggacaatttatcaagactggcatgat
tggatgaataaccagtttggccaaagccttgaactggatggactcatttatcttcgagcc
actccagagaaatgcaagagtagaatatatttacggggaagagaggaagaacaaggtatt
cctcttgaatatttagagaagcttcactataagcatgaaagctggctcctgcatagaacg
ctgagaaccaactttagttatctacaagaagtgcctatcttaatcctggatgtaaatgaa
gacttcaaagataaacaccacagtctggttgaaagggtcaaagaatttctgagcactttg
tga

DBGET integrated database retrieval system