KEGG   Hipposideros armiger (great roundleaf bat): 109394087Help
Entry
109394087         CDS       T04661                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hai01002]
    109394087 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hai03110]
    109394087 (TPP2)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109394087 (TPP2)
Peptidases and inhibitors [BR:hai01002]
 Serine peptidases
  Family S8: subtilisin family
   109394087 (TPP2)
Chaperones and folding catalysts [BR:hai03110]
 Intramolecular chaperones
  Subtilisin family
   109394087 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 109394087
NCBI-ProteinID: XP_019519418
Position
Un
AA seq 1316 aa AA seqDB search
MATSVTEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAILDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTTTVVEPKDGEIIGLSGRVLKIPENWTNPSGRYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANSCPSQVGASGFYLNITIEPS
IYHRLLREANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEAWRACIDSNEDGE
LSKSTVLRNYKEAQEYGTFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVGSIAAGHFP
EEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPN
SGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYS
LREKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACG
GIALILSGLKANNVNYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSF
ANKLGFTVTVGNNRGIYLRDPVQVAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNS
SWVQCPSHLELMNQCRHINIRVDPRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAA
KVNESSHYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVK
QRAYRSHEFYKFCSLPEKGTLTEAFPVLSGKAIEFCIARWWASLSDVNIDYTISFHGIVC
TAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPLSAKTKPLGSRDVLPNNR
QLYEMILTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQY
SMKLEKGDYTVRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSS
NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLSGSLTLSKTELGKKAGQSAAKRQGKFKK
DVIPVHYYLISPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRDLKIQWMTKLDSGDIYNE
LKETYPNYLPLYVARLHQLDAEKERMKRLNEIVEAANAVISHIDQTALAVYIAMKTDPRP
DAALIKKLIVFTSIGHELDKMPQISKHSRDYHCSLECSDMDKQKSTLVDALCRKGCALAD
HLLHTQDEDGAVSSDAEGREEEGESTLDSLTETFWETTKWTDLFDNKVLTFAYKHALVNK
MYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccgtcaccgaggagcccttccccttccacggcctcctgcccaagaaagag
accggggccgcctccttcctctgtcgctacccggagtatgacgggcggggagtgctcatc
gctatcctggacaccggggttgaccccggggcaccgggcatgcaggttacaactgatgga
aaaccaaaaatcattgacatcattgacacaacaggaagtggtgatgtgaataccactaca
gtagtagagccaaaagatggtgaaattattggcctttcgggaagagtgcttaagattcct
gagaactggacaaatccctcaggcagatatcacattggcataaaaaatggctatgacttc
tatccaaaggctctcaaggaaaggatacagaaagaacggaaggaaaaaatctgggaccct
gttcacagagtggccctggcagaagcctgtaggaaacaggaagaatttgatgttgccaac
agttgcccttcgcaagtcggtgctagtggtttttatttaaacattaccatagaaccatcc
atataccacagacttcttagagaagcaaataaactaatcaaggaggagcttcaaagccaa
gtggaattactaaattcttttgagaaaaaatatagtgatcctgggcctgtatatgactgc
ttggtatggcatgatggtgaagcctggagagcctgcattgattcgaatgaggatggggag
ttgagtaaatcgactgtgttgagaaactataaagaagcccaagaatatggcacttttggc
acagctgagatgttgaattattccgttaatatatatgatgatggaaacctgctctctatt
gtgaccagcggaggtgctcatgggacacacgtaggtagtatagctgctgggcattttccc
gaagagcctgaacggaacggggtagctcctggtgcccagattctttcaatcaagattggc
gataccagactgagcacaatggaaacaggcacaggccttataagggctatgatagaagtt
ataaatcataagtgtgatcttgtgaactatagctatggagaagcaactcactggccaaat
tctgggagaatttgtgaagtaattaatgaagcagtgtggaagcataatataatttatgtt
tcaagtgctggaaataatggtccatgcctttctacagttggttgtccaggtggaactacg
tcaagtgtaataggtgttggtgcttatgtttctcctgacatgatggttgctgagtattct
ctgagagagaaattacctgcaaatcaatatacgtggtcttctagaggccccagtgctgac
ggggcccttggagtgagcatcagcgcaccgggaggagccattgcttctgttcctaactgg
actttgaggggaactcagctaatgaacgggacatctatgtcttctcccaatgcgtgtgga
ggcatcgccctgatactttcaggtctgaaagctaataatgttaactacacagttcattca
gtcagaagagctctagagaacactgcagtgaaggctgacaatatagaagtatttgcccaa
ggacatggtattattcaggttgataaagcctatgactacctcgttcagaatacgtcattc
gctaataaattaggttttactgttactgttggaaataaccgtggcatctacctccgagat
cctgtccaggtggctgcaccttcagatcatggtgtcggcattgaacctgtgtttcccgaa
aatactgaaaactctgaaaaaatatcccttcaacttcatttagctttaacttcaaattca
tcttgggttcagtgtcccagccatttggaactcatgaatcaatgtagacacataaatata
cgtgtggatcccagaggcttaagagaaggattacattatacagaggtgtgtggctatgat
atcgcatcccctaatgcaggtcctctgttcagagttccaatcactgcagttatagcagca
aaagtaaatgaatcatcacattatgatctagcctttacagatgtccattttaaacctggt
caaattcgaagacattttattgaggttcctgagggtgcaacatgggctgaagttactgtg
tgttcatgttcttctgaggtgtcagccaagtttgttcttcacgcagtacagcttgtgaag
caaagagcatatcgaagccatgaattctataagttttgttcccttccagaaaaaggaaca
ttgactgaagcttttcctgtcttaagtgggaaagcaattgaattttgcattgcccgttgg
tgggcaagtcttagtgatgtcaatattgattacaccatttctttccatgggatagtgtgt
actgctcctcagttaaacattcatgcatcggaaggaatcaaccgttttgatgttcagtcc
tccttgaaatatgaagatctggctccctgcataactttgaagagctgggtccaaacacta
cgcccacttagtgcaaaaacaaaacctttaggatcaagagatgttttgccaaataatcgt
caactttatgagatgatccttacatataactttcatcaacccaagagcggggaagtaacg
ccaagctgcccactactttgtgaattattatatgaatcagaatttgacagccaactgtgg
attatatttgaccaaaataaaagacagatgggttcgggcgatgcctatccacatcagtat
tccatgaaactggagaaaggagattatacagttcgactacagattcgtcatgagcaaatc
agtgatttggaacgtcttaaagatcttccatttattgtttctcataggttgtctaatacc
ttgagcttagatattcacgaaaatcatagccttgcacttctaggaaagaagaaatcaagt
aatttaacactaccacccaaatataaccagccattctttgttacttccttacctgatgac
aaaatacctaaaggggcaggacctggatgctacctttcaggatccttaacattgtccaaa
actgaacttggaaagaaagctgggcagtctgcagcaaaacgacaaggaaaatttaaaaag
gatgtaattcctgttcattactacctaatatctccaccaacaaagaccaagaatggcagc
aaagataaggaaaaagattctgaaaaagagaaggatttaaaagaagagtttactgaagca
ttaagagatcttaaaattcagtggatgacaaagctggattctggtgatatttataatgaa
ttgaaagaaacatatcctaattatcttcctctgtacgttgctcgacttcatcaattggat
gctgaaaaggaacgaatgaaaagacttaatgaaattgttgaagctgcaaatgctgttatt
tctcatatagatcaaacggccctagcagtttatattgcaatgaagactgaccccaggccc
gatgcagctcttataaaaaaactcattgtcttcacaagtatcggtcatgagttggacaaa
atgcctcaaataagcaagcattctagagactaccactgttccctggagtgcagtgacatg
gacaaacaaaaatccaccctcgtagatgccctttgtagaaaaggatgtgcgctggccgac
catcttcttcacacacaggatgaagatggggctgtgtcaagcgacgcggaaggaagagag
gaggagggagaaagtactttggattctctgacagaaactttttgggaaactacaaagtgg
actgatctttttgacaataaggttttgacatttgcatacaagcatgcattagtaaataaa
atgtatgggagaggccttaaatttgcaactaaacttgtggaagaaaaaccaacaaaagaa
aactggaaaaattgtattcaactgatgaagttacttggatggacccattgtgcatctttt
actgaaaactggctccctatcatgtatcctcctgattattgtgtgttctaa

DBGET integrated database retrieval system