KEGG   Hipposideros armiger (great roundleaf bat): 109394140Help
Entry
109394140         CDS       T04661                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109394140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109394140
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109394140
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109394140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 109394140
NCBI-ProteinID: XP_019519505
Position
Un
AA seq 183 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVVSLTELNSVYIVQEYMETDLAHVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattaggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcctagtggaagccagttaacagacgatgtggtctctcttactgaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctcatgtgctggag
cagggccctttattggaagagcatgcccggcttttcatgtatcagctgctacgtgggctc
aaatacattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcgcggatcatggatccc
cattattcc

DBGET integrated database retrieval system