KEGG   Haloplanus sp. CBA1113: DU500_03045Help
Entry
DU500_03045       CDS       T05613                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
haj  Haloplanus sp. CBA1113
Pathway
haj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
haj01100  Metabolic pathways
haj01110  Biosynthesis of secondary metabolites
haj01130  Biosynthesis of antibiotics
haj01230  Biosynthesis of amino acids
Module
haj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:haj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DU500_03045
Enzymes [BR:haj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     DU500_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N Tautomerase_2
Motif
Other DBs
NCBI-ProteinID: AXG08016
UniProt: A0A345E744
Position
complement(603769..604785)
Genome map
AA seq 338 aa AA seqDB search
MTEVVGSGTKSAEDMTREQAAEAMRRIFDGDPHPTTLGAFWLANRWKHNTPEELAAFTDE
MCERAEYATPDADPVDCGANYDGKGRTAILGVAAGVVAAGAGTPVVAHSGDRTPTQKQDV
YKHVLDELDVATELTPRDSAAMVDETGVGFYYQPAFNPAVADLFDARDRMGVRTFVNTVE
TLANPAGASVHLGSFYHLAFAKKVVETFAESTFHDLDRVVMFQGMEGYDDIRPGYTKVAD
WSATGGFDDYEIETAAYGMDFAEEDLQVDDVAEDSARLTREVVAGDRTDHWYDAVALNAA
VRIYARDDADSLDSALDAARAAVDDGSAAAVLDDLRAF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtggtgggctcggggacgaaatccgcggaggacatgacccgcgaacaggcc
gccgaggccatgcgccgcatcttcgacggcgacccccacccgaccacgctcggcgccttc
tggctcgccaaccgctggaaacacaacacgcccgaagaactcgcggccttcaccgacgag
atgtgtgagcgcgccgagtacgccacccccgacgccgaccccgtcgactgcggcgccaac
tacgacggcaagggccggaccgccatcctcggcgtcgccgcgggcgtcgtcgccgccggc
gccggcacgcccgtcgtcgcccactccggcgaccggacacccacccagaaacaggacgtg
tacaaacacgtcctcgacgaactcgacgtggcgacggagttgaccccccgcgactccgcc
gccatggtcgacgagacgggcgttggcttctactaccagcccgcgttcaaccccgccgtc
gccgacctgttcgacgcccgggaccggatgggcgtgcgcacgttcgtcaacaccgtcgag
acgctcgccaaccccgccggcgcgagcgtccacctcggctccttctaccacctcgcgttc
gcgaagaaggtggtcgagacgttcgcggagagcacgttccacgacctggatcgagtcgtc
atgttccaggggatggagggctacgacgacatccgccccggctacaccaaggtggccgac
tggtcggcgaccggcggcttcgacgactacgaaatcgagacggccgcgtacggcatggac
ttcgcggaagaagacctacaggtcgacgacgtggccgaagacagcgcccgcctcacccgc
gaggtggtcgccggcgaccggaccgaccactggtacgacgccgtcgccctcaacgccgcc
gtccggatctacgcccgcgacgacgccgactccctcgattcggccctcgacgccgcccgt
gcggccgtcgacgacgggtcggccgccgccgtcctcgacgacctgcgggcgttctag

DBGET integrated database retrieval system