KEGG   Halomonas sp. KO116: KO116_01890Help
Entry
KO116_01890       CDS       T03800                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hak  Halomonas sp. KO116
Pathway
hak00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KO116_01890
Enzymes [BR:hak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KO116_01890
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KO116_01890
    1.1.1.-  
     KO116_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N ADH_N_assoc NAD_binding_3 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AJY50375
UniProt: A0A0D5M2F3
Position
2026788..2027864
Genome map
AA seq 358 aa AA seqDB search
MSQSISQQTMQAAVWYAAKDLRVEQVPVPTISDSHEVKVKVAACGICGSDLHEYAAGPIF
IPVGKPHPISGEQAPIIMGHEFAGEVVEVGEKVTRVKVGDRVAIEPILSPNKDGAYLMER
YNLTPLLGFHGLSGGGGGFSEFTVMGEHMVHKLPDDLSYEQGALVEPAAVALHAVRQSCL
KAGDSAVVFGAGPIGLMTIEALKAAGAAQIYAVEVAPSRKAKAEALGAIVVDPQQEDAVA
KLQVLSGGGVDVAFEVTGIPAVLNQALHSTHEGGEVVVVSIWEGEASFQPNDLVIQERTM
KGIIAYRHVYPAVMALMQRGYFRAEDMVTQRIPLADIVEEGFEALLNDKAQVKIIVTP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtccatcagtcagcaaacgatgcaggccgcggtttggtatgcagcaaaagat
ttacgcgttgagcaagtgccggttcccactatcagcgactcccatgaagtgaaggtgaaa
gtggctgcctgtggtatttgcggcagtgatttacatgagtatgctgccgggccgattttt
attccggtaggtaagccgcacccgatcagtggcgagcaggcgccgatcatcatgggccat
gagttcgctggggaagtggtcgaggtcggcgagaaagtcacgcgggtgaaggtaggcgac
cgcgtggccattgagccgattctctcacccaataaggatggcgcctacttaatggagcgc
tataacttaacaccgctattgggctttcatggcctctctggcgggggcggtggcttttcg
gagttcaccgtcatgggtgaacatatggtgcataagctgccggatgatcttagctacgag
caaggcgcgctggtcgagcctgcggcggtagcgttgcatgcggtgcgccaaagctgcctg
aaagcgggggatagcgcggtagtatttggcgctgggccgattggcttgatgacgattgag
gctctcaaggccgcaggcgctgctcaaatatatgccgttgaggtcgcgccttcacggaaa
gccaaagccgaagcgttaggggctattgtggttgacccgcaacaggaggatgcggttgcg
aagctacaagtcttgagtggtggcggggtagacgtggcgtttgaagtcaccggcattcct
gccgtgctgaatcaggcgctgcatagcacccacgaagggggtgaagtggtggtggtgagt
atttgggaaggagaggccagctttcagcctaacgacctagtcatccaagagcgcaccatg
aagggcattattgcctatcgccatgtttaccccgcggtaatggcactgatgcagcgaggc
tacttccgcgccgaggacatggtgacccagcgcattccactggcggatatcgtggaggag
ggctttgaggcgctgctaaacgacaaagcccaagtgaaaattatcgtgacaccctag

DBGET integrated database retrieval system