KEGG   Halomonas sp. KO116: KO116_02271Help
Entry
KO116_02271       CDS       T03800                                 

Definition
(GenBank) cytidyltransferase-related domain protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
hak  Halomonas sp. KO116
Pathway
hak00760  Nicotinate and nicotinamide metabolism
hak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KO116_02271
Enzymes [BR:hak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     KO116_02271
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     KO116_02271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AJY50746
UniProt: A0A0D5M3L0
Position
2415053..2416147
Genome map
AA seq 364 aa AA seqDB search
MATDIARSTTACDFDCLVFIGRFQPPHLGHLAIIREALKRARQVIVLVGSAWQARSLRNP
WRFDERQAMLRSGFDEADNQRLEITPLLDALYNDDVWVRDVQRKVRDLAAPANARLPRIG
LIGASRGQSSYYLSLFPQWESVSVPSVEGISASQIRERLFRSPSSTDDYLSTGAYHDLPP
GVVESVKKFCHVSAYKRLLEEQQLLDQYRQAWAHAPYPPIFVTVNAVVVQSGHVLLVRRT
AAPGKGLYALPGGFINPHERLLDACLRELRERLRLKVPEPVLKGSLRGQRLFDEPHRSWR
GRTLAEAFYFALRPDQQLPRLKPVKGGDHARWVALADLEPESLFEDHFFIIQNFLGLPAD
FGSS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgatattgcgcgctctactaccgcctgcgatttcgactgtttggtgtttatt
ggtcgctttcaaccacctcaccttggccacttggcgattattcgagaagcactaaaacgc
gcgcggcaagtgattgtactggtgggctctgcgtggcaagcacgctcattgcgtaacccg
tggcgatttgacgaacgccaagccatgctccgctcagggtttgatgaggctgataatcaa
cgcttagagattaccccgctactggacgcactctacaatgatgatgtctgggtgcgcgat
gttcagcgcaaagtgcgtgatttagccgcccctgccaatgcccgcctaccgcgcattggt
ttgattggagccagtcgcggacagtctagctactacctgtcgctattccctcaatgggag
tcggtcagtgtaccgtcggtagaagggatttcagcgagtcaaattcgtgagcgcctgttc
cgttcgcctagctccaccgatgactacttgagtacgggggcttaccacgacctgcccccc
ggcgttgtcgaaagtgtaaagaagttttgccacgtcagcgcctataagcgcctgctggaa
gagcagcagttattggatcaataccgtcaggcgtgggcccatgcgccctacccgcctatt
tttgtcacagtaaatgcagtcgtggtgcagtcgggtcatgtattgctggtacggcgtacg
gcggcaccgggtaaaggactttacgccctgccaggcggatttattaatcctcatgagcgt
ttactcgatgcctgtttgcgtgaactgcgcgaacggttgcgattaaaagtccccgagcct
gtgcttaaggggtcactacgtggccagcggctgtttgatgaaccccaccgcagttggcgc
gggcgcactttggcagaagctttctactttgcgttacgtccagaccagcagttgcctcgc
ttaaagcctgttaaagggggagatcatgcgcgctgggtggcacttgctgaccttgaacct
gagagcttgtttgaagaccacttttttattattcagaattttctcgggctgcctgccgat
tttggcagcagctaa

DBGET integrated database retrieval system