KEGG   Halomonas sp. KO116: KO116_02833Help
Entry
KO116_02833       CDS       T03800                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hak  Halomonas sp. KO116
Pathway
hak00220  Arginine biosynthesis
hak01100  Metabolic pathways
hak01110  Biosynthesis of secondary metabolites
hak01130  Biosynthesis of antibiotics
hak01230  Biosynthesis of amino acids
Module
hak_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    KO116_02833
Enzymes [BR:hak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     KO116_02833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AJY51306
UniProt: A0A0D5M565
Position
3031662..3032582
Genome map
AA seq 306 aa AA seqDB search
MATRHFLTLLDLTPDELDYLIQRAITIKTNLKAQGPVYTPLPNRTLAMIFEKSSTRTRVS
FETGMAQFGGHALFLSPRDTQLGRGEPIEDTARVLSEMVDAVMIRTFSHAGLETYANASS
VPVINALSDDYHPCQLLADIMTWTELRGSVKGHTAVWIGDGNNMCHSWINAARQFGFHLR
ICCPKGYEPRADIMAAAGDQITLLHDPQAAVKDADLITTDVWASMGQEEEQAKREADFAG
FQVTEAMLDQANQEVLFLHCLPAHRGEEISQTLLDDRRAVVWQEAGNRLHAQKALIEFLL
LGKVAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacgccatttcctgacgttgttggatttgaccccggatgagctggattatttg
atccagcgcgccattaccatcaagaccaaccttaaagcccaaggccctgtttatacaccc
ttacccaaccgcaccctggcgatgatctttgaaaaatcgtcaacacgtacgcgagtttca
ttcgaaacgggtatggcacagtttggtggtcacgcgctatttctctcccctcgcgacacc
caactaggccgcggcgagccgattgaagataccgctcgcgtactgtcggaaatggtcgat
gcggtaatgatccgcaccttttcccacgcaggcctggagacctacgccaacgccagcagc
gtgccggttattaacgccctgagtgatgactatcacccctgccagttgctcgccgacata
atgacctggaccgagctacgcggcagcgtaaagggccacacggcagtatggattggtgat
ggcaataacatgtgccactcctggatcaatgcggcccgtcagttcggttttcatttgcgc
atatgctgcccgaaaggctacgagccacgcgccgacatcatggcggccgctggtgaccag
ataacattgctgcatgacccgcaggcagcggtcaaagatgccgacctgatcaccaccgat
gtctgggcctccatgggccaggaagaagaacaggccaaacgagaggcggatttcgctggt
ttccaggtaaccgaagcgatgcttgatcaggcgaatcaagaggtactgttcctgcactgc
ctaccagcacatcgcggcgaagaaatcagccagacgctgcttgatgaccgccgcgccgtt
gtttggcaggaagccggtaaccgtctacatgcacaaaaagcgctgatcgaatttttgcta
ctgggcaaggttgctgagtaa

DBGET integrated database retrieval system