KEGG   Halomonas sp. KO116: KO116_02847Help
Entry
KO116_02847       CDS       T03800                                 

Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
hak  Halomonas sp. KO116
Pathway
hak00640  Propanoate metabolism
hak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KO116_02847
Enzymes [BR:hak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     KO116_02847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AJY51320
UniProt: A0A0D5M505
Position
complement(3045408..3048017)
Genome map
AA seq 869 aa AA seqDB search
MNTQYRKPLPGTALEFFDAREAVEDIQPGAYAKLPYTSRVLAEQLVRRCDPDLLTDALKQ
LIERRSDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVPTQLIVDH
SLAVEHAGSEEGAFEKNRAIEDRRNDDRFHFINWTKTAFENVDVIPPGNGIMHQINLEKM
SPVVQNRDGIAYPDTCVGTDSHTPMVDALGVISVGVGGLEAESVMLGRASMMRLPDIVGV
ELTGKLQPGITGTDMVLAITEFLRKERVVGAYLEFYGEGADALTVGDRATISNMTPEYGA
TAAMFYIDGQTIDYLKITGREDEQVALVETYAKHTGLWADSLTEVEYERVLTFDLSSVTR
TLAGPSNPHAHLPTSELAQRGIAVGLEAAQAEEKAGKMPDGAVIIAAITSCTNTSNPRNM
VAAGLIARNANRLGLLRKPWVKSSLAPGSKTVKMYLEEAGLMSELENLGFGVVAYACTTC
NGMSGALDPKIQQEIIERDLYATAVLSGNRNFDGRIHPHAQQAFLASPPLVVAYAIAGTI
RFDIEKDVLGVDQAGNPVTLKDIWPADEEIDAIVKSSVKPEQFRQTYIPMFDLDKSARAQ
VSPLYDWRPQSTYIRRPPYWEGNMAKVRTLKGMRPLAILPDNITTDHLSPSNAIQLNSAA
GEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRDADGNVKQGSLARVEPE
GQVTRMWEAIETYMARKQPLIIIAGADYGQGSSRDWAAKGVALAGVEAIAAEGFERIHRT
NLIGMGVMPLEFEPGTTRMTLGLDGTETFDVEGAVSPGAMLTLVIHRQNGESERVAVKCR
LDTAEEVSIYTAGGVLQRFAQDFLESTAA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaataccgtaaacccctgcctggcacagcgcttgagttttttgatgctcgc
gaggcggtggaagatatccagcccggtgcctatgcgaagctgccctatacctcgcgtgtg
ctggctgagcagttggtgcgccgctgcgatcctgacctgctcactgatgcgctgaaacag
ctgatcgagcgcaggagcgacctggattttccttggtacccggcacgtgtcgtctgtcac
gatatcctcggccagaccgcactggttgatttggccggactgcgcgacgctattgccgag
aagggcggcgaccccgccaaggttaatcctgtcgtgcccacccagctaatcgtcgatcac
tcattggcggtagagcacgcaggatcggaagagggtgccttcgaaaaaaaccgtgccatt
gaagatcgtcgtaacgatgaccgcttccattttatcaactggactaaaacggcctttgag
aacgtcgatgtaatcccccccggcaacggcatcatgcaccagatcaatctggagaagatg
tcgccggtggtacagaaccgcgacggcattgcctacccggatacctgtgtaggcaccgat
agccatacgcccatggtggatgcactcggcgtgatttcagtaggcgtggggggcctggag
gccgaaagcgtcatgctaggccgcgcttccatgatgcgcctgccggatatcgtcggcgtg
gagctgaccggcaagctacagccagggattaccggtaccgatatggtgctggcgattacc
gagttcctgcgtaaagagcgggtagtgggcgcttacctggagttttatggcgaaggtgcc
gacgcgctcaccgtgggtgatcgcgccactatctccaatatgacgcccgagtacggcgcg
actgcggcgatgttctacatcgatggccaaaccatcgattacctgaaaattaccggccgt
gaagatgagcaggtggcgctggtggaaacctacgccaagcacaccggcctgtgggcagat
agcttgaccgaggttgagtatgagcgagtactgacctttgacctctcatcggtgacgcgc
accttggccgggccttccaatccccatgcccatttgcctacttcagagctcgcccaacgt
ggtattgctgttgggcttgaggcggcacaggcggaagagaaagcgggcaaaatgcccgac
ggcgcggttatcatcgccgccattaccagctgcaccaatacctctaacccacgaaatatg
gtcgccgccgggcttatcgcccgtaacgccaaccggttgggtttgctgcgtaagccctgg
gtgaagtcgtcgctggcgccgggctcgaaaaccgtcaagatgtacctggaagaagctggg
ttgatgagcgagctggaaaacctcggctttggggttgtggcctacgcctgtaccacctgt
aacggtatgtccggggcgctggatccaaaaatccagcaggagattattgagcgtgatctc
tatgcgaccgccgtgctttccggcaaccgtaacttcgacggccgtatccacccccatgcc
caacaggcctttttggcgtctccgcccctggtggtcgcctacgccattgcgggtacgatt
cgctttgatatcgaaaaagacgtcctgggcgtggatcaggcgggaaatcccgtcactttg
aaggatatctggccagcggatgaagagatcgatgcgattgttaaatcgtcggtgaagccg
gagcagttccgccagacctatattcccatgttcgatctggacaagagtgcccgcgctcag
gtcagcccgctatatgactggcggccccagagcacctatattcgtcgcccgccttactgg
gagggcaatatggctaaagtgcgcactctgaaaggtatgcggccgctggcgatactgccg
gacaatatcaccaccgatcacttgtcgccctccaacgcgattcagttgaacagcgcggca
ggggagtacttggccaaaatgggcctgccggaggaagacttcaactcctacgccacccac
cgcggtgaccacctgactgcccagcgtgctaccttcgccaacccgaagttgttcaacgag
atggtgcgcgatgccgacggcaacgttaaacagggctcgctcgcgcgggtagagccggaa
ggccaagtcacccgcatgtgggaggcgattgaaacctacatggcccgcaagcagccgctg
atcattattgccggggcggattacggtcagggctcctcacgggactgggcggctaaaggc
gtggcgctggcgggcgtggaagcgatcgccgccgaaggctttgagcgtattcaccgcacc
aacctgatcgggatgggggtgatgccgctggagtttgagcccgggactacgcgtatgaca
ctgggcctggacggcactgaaacctttgatgtcgaaggcgccgtttcgccaggggcgatg
ctcaccctggtgatccaccgccaaaacggtgaaagtgagcgggttgcggtgaagtgtcgc
ctggataccgccgaggaggtgtcgatttacactgctggtggtgtactgcagcgttttgcc
caggactttcttgagtccacggcggcttaa

DBGET integrated database retrieval system