KEGG   Halomonas sp. KO116: KO116_03152Help
Entry
KO116_03152       CDS       T03800                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hak  Halomonas sp. KO116
Pathway
hak00970  Aminoacyl-tRNA biosynthesis
hak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hak00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KO116_03152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hak03029]
    KO116_03152
Enzymes [BR:hak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     KO116_03152
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     KO116_03152
Mitochondrial biogenesis [BR:hak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    KO116_03152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJY51623
UniProt: A0A0D5M757
Position
3399302..3400702
Genome map
AA seq 466 aa AA seqDB search
MSNSPSYWPLHQQVAAIASGDLSARDLVLAYTERLEAYDSQLATHVTLSNSALEEAAAID
KALARGEKLGPLAGACISVKDNYLTHNMPTRAGTDVAEISFPETDSHVVAKLRKAGAIIL
GKTRMHEFAWGNITPPTRNPWNTQCVPGGSSGGSAAAVAAGLCSAAMGSDTGGSVRIPAT
LCGTVGLKPTFGLVGRTGIVPHSWSLDHAGPLTRTVTDAALILEALVGSDADDPASLSAP
EIRYQPSANPTIKGFRIGVIRNHFSERISADVADNFATVQEWLKHKGVEIQEFDVPNLDY
GLGAIFAIELASSSAYHEQALQSGLTSGFQSDVRDLVEMGRLVSAVDYLHAEQLRSELCK
DFARIFNTVDLVISPTSPITAWNSGQWELDIEGSLESVLAASWRFTYPFNLTGMPAISVP
SGFDGKGLPIGLQIAGPPLSERKVLTFAAAFEAEHPHAEDKPVGFN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactctcctagctactggccgttgcaccaacaagtggcggcaatagccagcggc
gacctctccgcacgtgatcttgtccttgcctacaccgagcgtcttgaagcttatgacagt
cagttagcaacccatgtaactcttagcaactccgcactggaagaagccgcggcaatcgac
aaagcgctcgccaggggggaaaagctcggccccttggcaggcgcctgtatttcagtcaaa
gataactacctgactcataatatgcccacacgggcaggcactgacgtcgctgagatatct
tttcctgagacagacagccatgtggtggctaagctgcgcaaagctggggccatcatcctg
ggtaagactcggatgcacgagttcgcatggggtaatatcactccaccaacccgaaaccct
tggaatactcagtgcgttcccggaggttccagtggcggctctgccgcagccgtagcagct
gggctctgtagcgcggccatgggcagcgacaccggtggttcagtgcgcattcctgccact
ctatgcggcactgtggggctcaagcctaccttcggattagttggtcgaacggggattgtt
ccgcatagctggtcattagaccatgccggacctctaacccgaacggtaaccgatgcagcc
ctgattctcgaagcgttggtgggaagtgatgccgatgaccctgcctcattgagtgctcca
gagatcagatatcaaccgtcagctaaccccacaataaaaggctttcgcataggagtgatc
cgcaatcatttctcggagcgcatctccgctgacgtggcagacaactttgccacggtacaa
gagtggctaaaacacaagggggtggagattcaggaattcgatgtccctaatctagactat
ggcttgggagcaattttcgccatcgaattagcgtcatcctcagcttatcatgaacaggcg
ttacagagtggcttgacaagcggcttccaaagtgacgtacgagatctagtagaaatgggt
agactggtttccgctgtggattacctacatgcggaacagctacgctctgagctatgtaag
gatttcgcaagaatcttcaatacggtggatttggtaatctctccaactagcccaatcacc
gcatggaactcaggccaatgggaattagatattgaaggttccctagaaagtgtcctcgcc
gcttcatggcgctttacctaccccttcaacctaaccggcatgccggcaattagtgtgcct
tcggggtttgacggaaagggtctaccaatagggctacagattgcaggccctcccctgtcc
gaacgaaaagtgcttacatttgccgctgcttttgaggcagagcacccacatgctgaagat
aagccagttgggttcaattaa

DBGET integrated database retrieval system