KEGG   Halobacterium salinarum NRC-1: AAC82946.1Help
Entry
AAC82946.1        CDS       T00038                                 

Definition
(GenBank) unknown
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hal  Halobacterium salinarum NRC-1
Brite
KEGG Orthology (KO) [BR:hal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AAC82946.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAC82946
UniProt: O54523
Position
pNRC100:complement(174170..175345)
Genome map
AA seq 391 aa AA seqDB search
MDPALIALFAGAALASLFMAWVIGAGSSGATPYAPAVGANAISTMRAALLVGIFGFVGAV
TQGGNVSEAIGSGLVGGISLPIAGVILVLVLGAGLMAIGITTGYPIATAFTVTGAVIGVG
LALGGSPVWPKYQQIAAVWVLTPFVGGGIAFTIASLLPRPGVPERYSIPVLAGLVGAVLV
NIQFSFLGAGSAAGTVRGVGQRVLAVDGLTSAVGITGFAALVVATVVWWDVSRDERGGLR
RVLLALGSLVAFSAGGSQVGLAVGPLLPLLDEVGMVSTFAVLVGGGLGMLVGSWTGAPRM
IKSLAQDYSSLGPRRSISALVPSFLIAQLAVLLGVPVSFNEIVVSAIIGSGAAVGGREAV
DARKIGVTIGAWIGSFALSFALAYAAGALLL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgctctcatcgccctcttcgccggtgcagcgctcgccagcctgttcatggcg
tgggtcatcggcgccggctcgagtggggcgacgccgtatgcccctgccgtcggggcgaac
gctatctcgacgatgcgtgccgccctcctcgtcggtattttcggtttcgtcggtgccgtc
acgcaaggcggcaacgtctcggaagccatcgggagcggcctcgtcggtggaatcagtctc
ccgatcgccggcgtcatcctcgtactcgtgttgggggcagggctgatggcaatcggcatt
acgaccggctatccgatcgcgactgcgttcaccgtgactggcgccgttatcggcgtcggc
ctcgcgcttggtggttccccggtctggccgaagtaccagcagattgccgccgtctgggtg
ttgacgccgttcgtcggcggcggcatcgcgttcaccatcgcgagtctcctcccacgtccc
ggcgtccccgagcgatacagtatccccgtccttgcgggcctcgtcggggccgtcctcgtg
aatatccagttcagcttcctgggtgcggggagtgcggcaggtaccgttcgcggtgttgga
cagcgcgtgctggcagttgacggactcacgtcggcagtcgggattaccggcttcgcagcg
ctcgtcgtcgcgacggtcgtctggtgggacgtcagtcgcgacgagcgcggtggcctgcgg
cgtgtgctgctcgcgctcgggtcgctcgtagcgttctccgcgggcgggagccaggtcggg
ctcgccgttgggccgcttctcccgctgctcgacgaggtcgggatggtgtcgacgttcgcc
gtgcttgtcggcggcggtttggggatgctcgttggctcgtggacgggtgcgccacggatg
atcaagtcgctggcgcaggactactcatcgcttgggccgcgacgctctatctcggcgctc
gtgccctcgttcctgatcgcacagctggcagtattgcttggcgtaccggtctcgttcaac
gagatcgtcgtcagcgccatcatcggaagtggtgccgctgtcggcggtcgagaagcggta
gacgcccggaaaatcggtgtgacgattggtgcgtggatcggctcgttcgccctctcgttc
gccctcgcgtatgccgctggtgcgttgctgctgtag

DBGET integrated database retrieval system