KEGG   Halobacterium salinarum NRC-1: VNG_0128CHelp
Entry
VNG_0128C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00030  Pentose phosphate pathway
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01130  Biosynthesis of antibiotics
hal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VNG_0128C
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     VNG_0128C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AAG18750
UniProt: Q9HSQ3
Position
107649..108428
Genome map
AA seq 259 aa AA seqDB search
MTTRMDEPVLLTGASGRVGQAILGGIGDDYTWRLFDREPPTDDPDHEFVVADITDETAVR
EAASDVGAIVHLAGDPRPEAPWESVLRNNIDGTRTVLDAALAAGVDRVVFASSNHAVGHY
ETDRKPDLYRSDDDFRLDGTERPRPGNLYGVSKAAGETLGRYYHDEHGLTFAAVRIGNLT
AGHPPIDYERGQAMWLSPRDCAHLIDRCLSADYDYEVVYGISDNDRKYYSLARAKDALGY
EPRDNSAEWDGDEKLSGGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgaatggacgagccggtcctcctcacgggcgcttccgggcgcgtcgggcaa
gccatcctcggcggcatcggcgacgactacacgtggcggctgttcgaccgcgagccgccc
accgacgaccccgaccacgagttcgtggtggccgacatcaccgacgaaacagcggtgcgt
gaggccgccagcgacgtgggcgcgatcgtccacctggccggcgacccccgccccgaagcc
ccctgggagagcgtgttgcggaacaacatcgacggcacgcggacggtcctcgacgccgcc
ctggccgctggtgtcgaccgcgtcgtgttcgcgtcctcgaaccacgccgtcggccactac
gagacggaccgcaaacccgacctctaccgcagcgacgacgacttccggttggacggcacc
gaacgcccccgtccggggaacctctacggcgtctcgaaggccgccggcgaaacgctcggc
cggtattaccacgacgagcacggcctcacgttcgccgccgttcgcatcggcaacctcacc
gcgggccacccgcccatcgactacgagcgcggccaagcgatgtggctgtccccccgggac
tgcgcgcacctcattgatcgctgtctcagcgcggactacgactacgaggtggtctacggc
atctcggacaacgaccgcaaatactactcgctggcgcgtgccaaagacgcgctcggctac
gagccccgtgacaactccgccgagtgggacggcgacgagaaactctccggcggcagctga

DBGET integrated database retrieval system