KEGG   Halobacterium salinarum NRC-1: VNG_0327GHelp
Entry
VNG_0327G         CDS       T00038                                 

Gene name
gadD
Definition
(GenBank) glutamate decarboxylase
  KO
K18933  tyrosine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.25 4.1.1.11]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00350  Tyrosine metabolism
hal00410  beta-Alanine metabolism
hal00680  Methane metabolism
hal00770  Pantothenate and CoA biosynthesis
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    VNG_0327G (gadD)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VNG_0327G (gadD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VNG_0327G (gadD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    VNG_0327G (gadD)
Enzymes [BR:hal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     VNG_0327G (gadD)
    4.1.1.25  tyrosine decarboxylase
     VNG_0327G (gadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAG18904
UniProt: Q9HSA3
Position
complement(257872..258939)
Genome map
AA seq 355 aa AA seqDB search
MTRGEARRPPQEFDRVLSSMCTTPHPAAREAAQAFLATNPGDPETYPAVAERERDAVALL
GEIVGLSSPHGYIAAGGTEANLQAVRAARNRADADAVNVVAPASAHFSFQKAADVLGVEL
RLAPTDGDHRADVAAVADLVDGDTAVVVGVAGTTEYGRVDPIPALADIAAGVDANLHVDA
AWGGFVLPFTDHDWSFADAPVNTMAIDPHKMGQAPVPAGGFLARDPETLDALAIETPYLE
SDTQPTLGGTRSGAGVAGALASLRALWPDGYREQYERTQGNAEYLAAELAARGYDVVDPE
LPLVAADMPDAEFQALREEGWRISRTASDALRVVCMPHVTREMLAAFLDDVDALA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtggggaagcgcggcggccgccacaggagttcgaccgggtgctgtcctcgatg
tgcacgacgccgcatcccgcggcccgcgaggctgcacaggcgtttctggcgaccaacccg
ggcgacccggagacgtatccggcggtggccgaacgcgagcgcgacgccgttgcactgctc
ggtgagatcgtggggttgtcgtcgccacacggctacatcgctgccggcggcacggaggcg
aacctccaggcggtccgggccgcgcgcaaccgcgccgacgccgacgccgtgaacgtggtt
gcgccggcgagcgcgcatttcagcttccagaaggccgctgacgtgctcggcgtggagttg
cggctcgcgcccactgacggggatcaccgggcggacgtggctgcagtggcggacctcgtg
gacggcgacaccgccgtggtggtcggggtggccggaacgaccgagtacgggcgggtggac
ccgatcccggcgctggcggacatcgcagccggggtggacgcgaacctccacgtcgacgcg
gcctggggtgggttcgtgttgccgttcaccgaccacgactggagcttcgccgacgcgccg
gtgaacacgatggccatcgacccacacaagatggggcaggcaccggttcccgcagggggg
tttctggcgcgggatcccgagacgctggacgcgctcgccatcgagacgccgtatttggag
tccgacacccagccgacgctgggcgggacgcggtcgggggccggcgtcgcgggcgcgctc
gccagcctgcgggcgctgtggccggacggctaccgcgagcagtacgagcgcacgcagggc
aacgctgagtacctcgccgcggagctcgccgcccgcggatacgacgtcgttgaccccgag
ttgccgctggtcgctgccgacatgcccgacgccgagttccaggcgctgcgcgaagagggg
tggcggatctcccggacggcgtcggacgcgctgcgcgtggtctgtatgccccacgtcacg
cgggagatgctggcggcgttcctggacgacgtcgacgcgctggcgtga

DBGET integrated database retrieval system