KEGG   Halobacterium salinarum NRC-1: VNG_0446GHelp
Entry
VNG_0446G         CDS       T00038                                 

Gene name
gcd
Definition
(GenBank) glucose dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00030  Pentose phosphate pathway
hal01100  Metabolic pathways
hal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VNG_0446G (gcd)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     VNG_0446G (gcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2 NAD_binding_10 SLT_2
Motif
Other DBs
NCBI-ProteinID: AAG18991
UniProt: Q9HS17
Position
345205..346275
Genome map
AA seq 356 aa AA seqDB search
MDAIVVSKADRTPRLVDRPRPDPTPGSVLVRTLRVGVDGTDHEVIAGTHGGFPEDADELV
LGHEAIGVVADPTDTRFSAGQLVAPTVRRPRGDPTPQFDRGQPDMAAPGTYVERGIDGAD
GFMADYFTSPADALVALPDSLAAHGFLTEPVSVAEKAIELALASRSAFDWRPDSALVLGN
GSLGLLTLAILAARDDTETLYCLGRRSRPDPTIDIIERLGATYIDSRTTPVADIPAAHQP
VDMVYEATGHAKHAFDAIDALAPAGVAALLGVPAAGWTFEVPGSDLHRSLVLENKAVVGS
VNSNARHFRAAADTLAALPDWLCDAIVTGVHDTAAFADAFRDGETSIKTAVQFDTR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaatcgtcgtctcgaaggccgaccgcacaccacggctggtcgaccggccccgt
ccggacccaacacccggctcggtgctcgtgcgcacgctccgcgtcggcgtcgacggcacc
gaccacgaagtgatcgccggcacccacggcggcttccccgaggacgccgacgagctcgtg
ctcggccacgaagccatcggcgtcgtcgcggatccgaccgacacccggttctccgcgggc
caactcgtcgcgccgaccgtgcgccgaccgcggggcgaccccaccccgcagttcgaccgc
ggccaacccgacatggcggcccccggtacgtacgtcgagcgcggcatcgacggcgccgac
gggttcatggccgactacttcaccagccccgcggacgcgctcgtcgcgctccccgactcg
cttgccgcccacggcttcctcacggaaccggtgtcggtcgccgagaaagcgatcgaactc
gcgctcgcttcgcggtcggcgttcgactggcggccggactccgcgctcgtgttgggcaac
ggctcgctcggcctgctcacgctcgccatcctcgccgcccgcgacgacaccgagacgctc
tactgtctcggccgccgcagccgccccgacccgacgatcgacatcatcgagcgactcggc
gcgacctacatcgactcccgcaccacgccggtcgccgacatccccgccgcccaccagccc
gtcgacatggtgtacgaagccaccgggcacgcgaaacacgccttcgacgccatcgacgcg
ctcgcccccgccggcgtcgctgccctcctcggcgttcccgccgccggctggacgttcgaa
gtcccgggcagcgacctccaccgcagcctcgtcctggagaacaaagcggtggtcggcagc
gtcaactccaacgcccgccacttccgcgccgccgccgacacgctggccgccctccccgac
tggctgtgtgacgccatcgtcaccggcgtccacgacaccgcagcgttcgcggacgcgttc
cgggacggcgaaacctccatcaagacggccgttcaattcgacacccgatga

DBGET integrated database retrieval system