KEGG   Halobacterium salinarum NRC-1: VNG_1251GHelp
Entry
VNG_1251G         CDS       T00038                                 

Gene name
helA
Definition
(GenBank) ATP-dependent helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
hal  Halobacterium salinarum NRC-1
Brite
KEGG Orthology (KO) [BR:hal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_1251G (helA)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     VNG_1251G (helA)
DNA repair and recombination proteins [BR:hal03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    VNG_1251G (helA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD_assoc DEAD Helicase_C ResIII AAA_19 AAA_25 HypA SNF2_N
Motif
Other DBs
NCBI-ProteinID: AAG19610
UniProt: Q9HQA5
Position
complement(940842..943682)
Genome map
AA seq 946 aa AA seqDB search
MSETGGGRMDAFTHLGSEVRNALSERGFTTPTEPQRRAVPALADGRNGLVVAPTGTGKTE
TAMLPVFDALVSDGGPPDGFGALYVTPLRALNRDMRERLDWWGETLGLEVDVRHGDTTDY
QRRQQATDPPDVLVTTPETLQAMLTGSTLRDGLADVEHVVVDEVHELAGAKRGAQLAIGL
ERLVEVAGRVQRIGLSATVGDPHEIGAFLTGGRGCEIIEVDVTSNVSFEVREPAVTDADE
RLASELLTTPAMASHVRAIREIVDRHDSVLIFVNTRQTAEALGSRFKELDANIGVHHGSL
SKDARIDVEDRFKSGDLDGLLCTSSMELGIDVGGIDHVVQYNSPREVKRLLQRVGRAGHS
RDAVSEGTVITGSTDDTLEALAVADRANEGAVEDTQVHHGSLDTVANQIVGVVMDVGETE
AWHAYNIITRAYPFKQLTEETFRAVAMELHRNRVVYVDEDDDTISTSGGTWQYYYANLSM
IPDEETYEVYDMAGGRQVGTLDERFVVNFAEPGATFVQRGEMWRITNIDEDDQQVEVSPI
EDPAGEVPSWTGQEIPVPYAVAQAVGGMRATGGRQLGTGTPKDAVARDVAARYPTTHRTA
GSALDRMARHVTEQDAPVPSAERIVVEQAGSTVVVNACFGHEVNETLGRLVSALLGQQTG
SSVGLDAGPYRIELEVPSRVSATDVVAVLRDTDPDHVAGLLELSLKQSETLKFTLAQVAA
KFGALKRWKGRDGVGLSRLLGALEGTPVYEEAIREVFHTTLDVARASDVLARVQSGELGV
EIVGERTAVGAGGRSAGTELLTPEHADASVVQTIKDRIQDDRVKLFCVHCADWSHETMVR
RVTDQPECPRCGSTRIAALSPWADEVITAVRADDKDDEQDDRTQRAYRNASIVQSHGKRA
VIALSARGVGPRNAARVINRHRETEAEFYRDILEREREYARTKAFW
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaccggtggtggccggatggacgcgttcactcacctcggcagcgaggtccgg
aacgcgctctccgagcgcgggttcaccacgccaacggagccccaacgtcgcgcggtgccc
gcgctcgcggacgggcgaaacgggttggtcgtcgccccgacggggaccgggaagacggag
acggcgatgctgcccgtcttcgacgcgctcgtctcagacggcgggccgcccgacgggttc
ggtgcgctgtacgtgacgccgctgcgggcgctgaaccgggacatgcgcgagcgcctggac
tggtggggggagacgctgggcctggaagtcgacgtgcgacacggggacacgacggactac
cagcgccgacagcaggccaccgatccgccggacgtgctggtgaccacgccggagaccctg
caggcgatgctgaccgggtcgacgctccgggatggacttgcagacgtcgagcacgtcgtc
gtcgacgaggtccacgagctggcgggcgcgaagcgcggcgcgcagctggcgatcgggctc
gaacgcctcgtggaggtggccggtcgcgtccagcggatcgggctgtcggcgacggtcggg
gatccccacgagatcggagcgttcctcaccggcggccgggggtgtgagatcatcgaagtc
gacgtgacgtcgaacgtgtcgttcgaggtgcgggagccggccgtcacggacgccgacgag
cggttggcgagcgaactgctgaccacgccggcgatggccagtcacgtccgcgcgatccgg
gagatcgtcgaccgccacgactcggtgttgatcttcgtgaacacccgccagaccgcggag
gcgctggggtcgcggttcaaggagctggacgcgaacatcggcgtgcaccacggctcgctg
tcgaaagacgcccgcatcgacgtcgaggaccgcttcaagtccggcgacctcgacggcctg
ctgtgcacgtcctcgatggagctcgggatcgacgtgggcgggatcgaccacgtggtgcag
tacaactcgccccgggaggtcaagcgcctgctccaacgcgtggggcgggcaggccatagc
cgggacgcggtcagcgagggcaccgtcatcacgggcagcaccgacgacaccctggaggcg
ctggcggtcgcagaccgggccaacgagggcgccgtcgaggacacccaggttcatcacggc
agcctcgacactgttgcgaaccagatcgtcggcgtcgtgatggatgtcggggagaccgag
gcgtggcacgcgtacaacatcatcacgcgcgcgtatccgttcaagcagctcaccgaagag
acgttccgggcggtggcgatggagctccaccggaaccgcgtggtgtacgtcgatgaggac
gacgacaccatctcgacgtccggggggacgtggcagtactactacgcgaacctctcgatg
atccccgacgaggagacctacgaggtgtacgacatggccggcggccggcaggtcggcacg
ctcgacgagcggttcgtggtgaacttcgcggagccgggcgcgacgttcgtgcagcgcggc
gagatgtggcgcatcacgaacatcgacgaggacgaccagcaggtggaggtctcgcccatc
gaggacccagcgggcgaggtgccgtcctggacgggccaagagatcccggtgccgtacgcg
gtcgcgcaggcagtcggcgggatgcgggcgacgggcggccggcagctcggcaccgggacg
cccaaagacgcggtggcgagagacgtggcggcgaggtatccgaccacccaccggaccgcc
ggcagcgcgctcgaccggatggcccgccacgtgaccgagcaggacgcgcccgtgccgagc
gccgagcggatcgtcgtcgagcaggccggctcgacggtggtggtgaacgcgtgtttcggg
cacgaagtcaacgagacgttggggcggctggtgtcggcgctgctcggtcagcagacgggg
tcgtcggtggggctggacgcaggcccgtaccgcatcgagttggaggtcccgagccgggtg
agcgccacggacgtcgtggcggtgttgcgcgacaccgaccccgatcacgtggccgggttg
ctcgaactcagcttgaaacagtccgagacgctgaagttcacgctcgcacaggtcgccgcg
aagttcggcgcgctcaagcgctggaaggggcgggacggcgtggggttgtcccggctgctg
ggggcgcttgagggcacgcccgtctacgaggaggcgatccgggaggtgttccacaccacg
ctggatgtggcgcgcgctagcgacgtgctcgcgcgcgtgcagtccggcgagctcggcgtc
gagatcgtgggcgagcgcacggccgtgggggccggcggccggtcggcgggaacggagttg
ctcacgccggagcacgccgacgccagcgtcgtgcagacgatcaaagaccgcatccaggac
gaccgcgtgaagctgttctgcgtgcattgcgccgactggagccacgagacgatggttcgt
cgggtcaccgaccagccggagtgcccccggtgtgggtcaacgcggatcgcggcgctgtcg
ccgtgggcggatgaggtgataacggcggtgcgtgccgacgacaaggacgacgagcaggac
gaccggacacagcgcgcgtaccggaacgccagcatcgtgcagagccacgggaagcgggcc
gtgatcgcgttgtcggcgcgcggcgtcggcccccggaacgccgcccgcgtcatcaaccgc
caccgggagacggaggcggagttctaccgggacatcctcgagcgcgagcgcgagtacgcg
cgcaccaaggcgttctggtag

DBGET integrated database retrieval system