KEGG   Halobacterium salinarum NRC-1: VNG_1515GHelp
Entry
VNG_1515G         CDS       T00038                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00240  Pyrimidine metabolism
hal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VNG_1515G (tdk)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VNG_1515G (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AAG19808
UniProt: Q9HPQ9
Position
complement(1126648..1127235)
Genome map
AA seq 195 aa AA seqDB search
MHAITNSGWVEVITGSMFSGKTEELLRRLRRAEIAGQDVAAVTPAVDDRYGEATLGSHAG
RSWAATVVEPTAEGVASIPTLLNGEQVVAIDEANFFPAELVDVCQELAADGRRVVLSGTD
QTFRGEPFEPVPQLMAIAEYVDKMRAICMQCGEPATRNQRLIEGEPAHYDDPTVMVGAEE
TYEARCRNCHVVRRE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcacgaactccgggtgggtggaggtgatcacggggtcgatgttctcgggg
aaaaccgaggagttgttgcggcgactgcggcgcgcggagatcgcgggccaagacgtcgcg
gcggtcacgcccgccgtcgacgaccggtacggcgaggcgacgctgggctcgcacgccggc
cggtcgtgggcggcaacggtcgtcgaacccaccgccgagggcgtcgcgtcgatccccacg
ctgctcaacggcgagcaggtggtcgccatcgacgaagccaacttcttcccggccgaactc
gtcgacgtctgccaggagctcgcggcggacggacgtcgggtggtgctgtcgggcaccgat
cagacgttccgcggggagcccttcgagccggtgccacagctgatggcgatcgccgaatac
gtcgacaagatgcgcgcgatctgcatgcagtgtggggaaccggccacccgcaaccagcgc
ctcatcgagggcgagcccgcccactacgacgaccccaccgtcatggtcggcgccgaggag
acctacgaggcgcggtgccggaactgccatgtcgtgcgccgtgagtaa

DBGET integrated database retrieval system