KEGG   Halobacterium salinarum NRC-1: VNG_2636G
Entry
VNG_2636G         CDS       T00038                                 

Gene name
uvrA
Definition
(GenBank) excision nuclease chain A
  KO
K03701  excinuclease ABC subunit A
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    VNG_2636G (uvrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_2636G (uvrA)
DNA repair and recombination proteins [BR:hal03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     VNG_2636G (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      VNG_2636G (uvrA)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_29 AAA_16 AAA_21 AAA_23 RsgA_GTPase AAA_22 DnaJ_CXXCXGXG AAA_14 ATPase cobW NACHT Viral_helicase1 NMDAR2_C
Other DBs
NCBI-ProteinID: AAG20669
UniProt: Q9HMA2
Position
1971212..1974160
AA seq 982 aa
MSEEYIEVRGAEEHNLTDLDVELPRESLNVVTGLSGSGKSSLAFETIYAEGQRRYIESLS
AYARNFLGQMDKPQVESVEGLSPAISIDQKNAANNPRSTVGTVTELHDYLRLLYARVGTP
HCPECGREVGEQSAQQMVRRIFDLPAGTKAKLLAPVVRDQKGAFEDLFEDLVNEGYSRVA
VDGESYDLAYDDPDLDENYDHTVDVVVDRVTVTEDARSRITDSVETALDEADGVLKVVVP
DAGPDTELGGATARSTGDLADDAADDRLVVEFSDALACTHCGIDISEIETRSFSFNSPHG
ACPECEGIGNTKEVSEDLVVVDTSKPIKDVFEAWSYQRSYYRTRLDAVAAHFGVSVDTPF
DELDDAVQQAFLYGTSDEVVFERSTKNGTRRKEKRFEGVIPNLERRYVETDSESTRDHIE
TYMSVTTCPACDGTRLKPSSRAVLVDGTPITDVNRMSIGDALAHFEGMEAELDARDTKIA
AEILKEIRARLGFMTEVGLEYLTLDREASTLSGGESQRIRLATQIGSGLVGVLYVLDEPS
IGLHQRDNDRLLNTLEELRDLGNTLIVVEHDEETMRRADTVIDMGPGPGRHGGEVVANGS
VADVMAATDSITGDYLAGREQIPVPDERRDYDDTLTVTGARQHNLRNLDVDLPIGAFTAI
TGVSGSGKSTLMHDILYKGLAREMNDNTSVDPGDHDAIEGTEHVETVRLIDQSPIGRTPR
SNPATYTGIFDYIREKFAQTKLATQRGYKKGRFSFNVKGGRCEACGGQGTQKIDMNFLSD
VHVPCEECGGDRYNDETLDVTFKGKTIADVLDMSVEEAHDFFEADSRLGRRLQLLEDVGL
DYMRLGQPSTTLSGGEAQRVKLAEELGKQSSGDTLYLLDEPTTGLHSHDERKLIEVLQRL
TDRGNTVVVIEHELDLVKNADHVVDLGPEGGAAGGDVVATGTPEAVARTDDSHTGRYLRD
KLPAVDREGPRSGREKPALSDD
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgagcgaagagtacatcgaggtccgtggcgccgaagaacacaacctcacggacctcgac
gtggagcttccccgcgagtcgctgaacgtcgtcacggggctgtccggatccgggaagtcg
tcgctcgcgttcgaaacgatctacgccgaagggcagcgccggtatatcgagagcctctcg
gcgtacgcgcgcaacttcctcgggcagatggacaaaccacaggtggagtccgtcgagggg
ctctccccggcgatctccatcgaccagaagaacgccgcgaacaacccccggtcgacggtc
ggcaccgtcaccgagctccacgactacctgcgactgctgtacgcccgcgtcggcacgcca
cactgcccggagtgtggccgcgaggtcggcgagcagtccgcccagcagatggtgcggcgc
atcttcgacctccccgcgggaacgaaagcgaagctgctcgcaccggtcgtgcgcgaccag
aagggtgccttcgaggacctcttcgaggacctcgtcaacgaggggtactcgcgggtggca
gtcgacggcgagtcctacgacctcgcgtacgacgaccccgacctcgacgagaactacgac
cacacggtcgacgtggtggtcgaccgcgtgaccgtcaccgaggacgcccgctcccggatc
actgatagcgtcgaaaccgccctcgacgaagccgacggcgtgctcaaagtcgtcgttccg
gacgccggacccgacaccgaactcggcggcgcgacggcgcgctcgaccggcgacctcgcc
gacgacgccgccgacgaccgcctcgtcgtggagttcagcgacgccctcgcgtgcacgcat
tgcggcatcgacatcagcgagatcgagacgcgcagcttctcgttcaacagcccccacggg
gcgtgccccgaatgcgagggcatcgggaacaccaaggaggtcagcgaggacctcgtcgtc
gtcgacacctccaagccgatcaaagacgtcttcgaggcgtggagctaccagcgctcgtac
taccgcacgcgcctggacgccgtcgccgcgcatttcggagtcagcgtcgacacgcccttc
gacgagctagacgacgccgtccagcaggcgttcctctacggcaccagcgacgaggtcgtc
ttcgagcgctccacgaaaaacggcacccgccgcaaggagaagcgcttcgagggcgtcatc
ccgaacctcgaacgccggtacgtcgagacggattcggagtccacccgggaccacatcgag
acgtacatgtccgtgacgacgtgcccggcctgcgacggcacccgcctgaagccgtcctcg
cgggccgtcctcgttgacggcaccccgatcaccgacgtcaaccggatgagcatcggcgac
gccctcgcacacttcgagggcatggaagccgagctggacgcccgggacaccaagatcgcc
gccgagatcctcaaagagatccgcgcccgcctcgggttcatgacggaagtgggcctggag
tatctcacgctggaccgcgaggcgtcgacgctctccgggggggaatcccagcgcatccgc
ctcgccacccagatcgggtccgggctggtcggcgtactgtacgtcctcgacgagccctcc
attggactccaccagcgcgacaacgaccggctgttgaacaccctcgaagagctgcgggat
ctcgggaacacgctgatcgtcgtcgagcacgacgaggagacgatgcgccgcgccgacacc
gtcatcgacatggggccggggccgggccgccacggcggcgaggtcgtcgccaacggcagc
gtcgccgacgtcatggccgccaccgactccatcaccggcgactacctcgcgggccgcgag
cagatccccgtccccgacgagcgccgcgactacgacgacacgctcaccgtcacgggtgcc
cgccagcacaacctccggaacctcgatgtcgacctcccgatcggcgcgttcaccgccatc
acgggcgtctccggctcggggaagtcgacgctcatgcacgacatcctctacaaggggttg
gcccgcgagatgaacgacaacacgagcgtcgaccccggcgaccacgacgccatcgagggc
accgaacacgtcgagacggtgcggctcatcgaccagagcccgatcggccgcacgccccgc
agcaacccggccacctacaccggcatcttcgactacatccgggagaagttcgcgcagacg
aaactcgccacgcagcgcggctacaagaaggggcggttctcgttcaacgtcaaaggcggc
cggtgtgaggcctgtggcggccagggaacccagaagatcgacatgaacttcctctcggac
gttcacgtgccctgcgaggagtgtggcggcgaccgctacaacgacgagacgctcgacgtc
acgttcaagggcaagacgatcgccgacgtgctcgacatgagcgtcgaggaagcccacgac
ttcttcgaggccgacagccggctcggccgccgcctccagttgctcgaagacgtcggcctc
gactacatgcgcctcggccagccgtccaccacgctctccggcggggaagcccagcgcgtc
aagctcgccgaggagctgggcaagcagtcctcgggggacacgctgtacctcctcgacgaa
cccaccaccgggctccacagccacgacgagcgcaagctcatcgaggtgctccagcggctc
accgaccgcggcaacaccgtcgtcgtcatcgaacacgagttggatctcgtgaaaaacgcc
gaccacgtcgtcgacctcggccccgagggcggcgcggccggcggcgacgtcgtcgccacc
ggaaccccggaggcggtcgcgcgcaccgacgacagccacaccggccgctacctccgcgat
aagctgccggcggtcgaccgcgaggggccgcgaagcggccgcgagaaaccggcgctgagc
gacgactga

DBGET integrated database retrieval system