KEGG   Halorubrum sp. BOL3-1: EKH57_05720Help
Entry
EKH57_05720       CDS       T05834                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
halb  Halorubrum sp. BOL3-1
Pathway
halb00520  Amino sugar and nucleotide sugar metabolism
halb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EKH57_05720
Enzymes [BR:halb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     EKH57_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR NAD_binding_10 TrkA_N NmrA
Motif
Other DBs
NCBI-ProteinID: QAU12256
UniProt: A0A410TN78
Position
994623..995564
Genome map
AA seq 313 aa AA seqDB search
MSDGSSLVAGGAGFLGSQLCESLLDDGHQVYCLDNESSGRSENIESFRNRNQFTYIKGDV
CDLPDLPAVDEVYHFASRASPRDFKEHPIEIARSNTEGTRNLLEYCVEQDARMLYASTSE
VYGDPEEHPQTESCNGNVNIRGPRSCYDESKRFGETLVVTYEREHDIDVRTARIFNTYGP
RMRQDDRRVVPIFIRQALNGENLTVYGDGTQTRSFCFVEDEIRGLRRLMETNGLCGEVVN
IGSDHEVTITELAEVILSAVESSSKITHKPLPKDDPERRQPDITRANTLLDWWPKTELNE
RIDRTIQQFTGSA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggctcatctctcgtcgccggcggggccggattccttggaagccagctgtgc
gagtcgttacttgatgacggtcaccaggtctactgtctcgacaacgagagcagcggccgg
tcggaaaacatcgaaagcttccgaaatcggaatcagtttacctatatcaagggtgacgtt
tgtgatctccctgatctccccgctgtagatgaagtgtatcattttgcgtcacgcgcgtcg
ccgagagatttcaaagaacacccaatagagattgctcgaagcaacacagaggggacccga
aatctgctggaatactgcgttgaacaggatgcacgaatgctctatgcgagtaccagcgaa
gtctacggggatccagaagaacaccctcagacagagagctgcaacgggaacgtcaatatc
cgcggtcctcggagctgttacgacgagtcaaaacggttcggagaaacacttgtcgttaca
tacgaacgagagcatgatattgatgtccgcactgcgaggattttcaacacgtacggtccg
cggatgagacaagacgataggcgcgtcgtcccgatattcatcaggcaggcgctcaacggc
gaaaacctgaccgtgtatggcgatgggacgcagactcgtagcttctgtttcgttgaggat
gaaattcgcggtcttcgtcgtctgatggaaacaaatggcttatgcggggaagttgtgaac
attggaagcgaccacgaagttactatcacagaactcgctgaagtgattttgtctgcggtg
gagtcctcgtctaaaatcacacacaagccacttccaaaagatgatccggaacggcgacag
cccgacattacacgggcaaatacactacttgactggtggccgaaaacggagcttaacgag
agaattgaccgcacgattcaacagttcactggatccgcgtaa

DBGET integrated database retrieval system