KEGG   Halorubrum sp. BOL3-1: EKH57_06505Help
Entry
EKH57_06505       CDS       T05834                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
halb  Halorubrum sp. BOL3-1
Pathway
halb00730  Thiamine metabolism
halb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EKH57_06505 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:halb03000]
    EKH57_06505 (tenA)
Enzymes [BR:halb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     EKH57_06505 (tenA)
Transcription factors [BR:halb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    EKH57_06505 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Haem_oxygenas_2 DUF4685
Motif
Other DBs
NCBI-ProteinID: QAU12395
UniProt: A0A410TNP8
Position
1146865..1147524
Genome map
AA seq 219 aa AA seqDB search
MGFSDRLLDAGSDVWDAQKEHPFVVELADGSLDEAAFRHWVRQDYRYLLDYARVFALAGA
TADDEETMRRLTGTAHATLADEMELHRSFAAEYGLSAADLEAVEKAPTCAAYTDFLVRTA
HEGSIAEVAAAVYPCGQGYLDVADHMAALATEDHRYTPFIEKYTSDEFRETVSWMRGLVD
RYGEEHPGERDAMRAAFLRSARLEHAFWEMCYSREERPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggattcagtgaccgactcctcgacgccggatcggacgtctgggacgcacagaaggaa
cacccgttcgtcgtcgaactcgcggacggcagcctcgacgaggcggcgttccgacactgg
gtgcgacaggactaccggtacctgctcgactacgcccgcgtcttcgcgctcgcgggggcg
acggcggacgacgaggagacaatgcgacggctgacggggaccgcccacgccaccctcgcg
gacgagatggagcttcaccggtcgttcgccgccgagtacgggctctcggccgcggacctc
gaggccgtcgagaaggcgccgacctgtgccgcgtacaccgacttcctcgtgcggacggcc
cacgagggatcgatcgcggaggtcgcggccgccgtctacccgtgcggacagggctacctc
gacgtcgcggaccacatggccgccctcgcgaccgaggaccaccggtacaccccgttcatc
gagaagtacacgagcgacgagttccgcgaaacggtctcgtggatgcgcgggctcgtcgac
cggtacggcgaggagcaccccggcgagcgcgacgccatgcgggcggcgttcctgcggagc
gccaggctcgaacacgcgttctgggagatgtgctacagtcgggaggagcgaccggtgtga

DBGET integrated database retrieval system