KEGG   Halorubrum sp. BOL3-1: EKH57_09075Help
Entry
EKH57_09075       CDS       T05834                                 

Definition
(GenBank) FAD-dependent oxidoreductase
Organism
halb  Halorubrum sp. BOL3-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Pyr_redox_3 HI0933_like Amino_oxidase NAD_binding_9 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QAU12862
UniProt: A0A410TQ14
Position
1683747..1685171
Genome map
AA seq 474 aa AA seqDB search
MSDTDLVIIGGGISGASLLYTVAKFTDIESVTLIEKEREIAAINSDRTNNSQTLHFGDIE
TNYTLEKAEEVKEGAELLAGYLEGEDPDREMHSKRSKMVLGVGDDEVAKLEERYHENGFG
DLYPKLREIGREEIAELEPNVVEGRDPGTELKALQTSDGYVVDYGVVAESFVDAAREEEG
VSVHLGTTVTNVDDRGEEFRVETDDGDFDAEAVVVAAGSHSLQFAKEMGYGEGMSLLPVA
GSFFLADDLLNGKVYTLQMKKLPFAAVHGDADVHDDGITRFGPTAKLVPALERGHLSTVS
DFVDVFGFNPDSVLSYVNILSDRILFPYVVRNLVYDLPVVGKRAFLPDVQKVVPSVGVDD
IDRAKGYGGVRPQIVDTENKELDMGEAKITEDGILFNITPSPGASTALKNAMTDIETVLG
FFEDDYEFDEAAFRDATIENFPRLNDETAGDDAADADGTTDADADDGVAVGADD
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaccgatctcgtaatcatcggcgggggaatcagcggggcgtcgctgctgtac
acggtcgcgaagttcaccgacatcgagagcgtcacgctgatcgagaaggaacgggagata
gctgcgatcaactctgaccggacgaacaactcgcagacgctccactttggggacatcgag
acgaactacaccctggagaaggcggaggaggtcaaggagggcgcggagctgctcgcggga
tacctcgaaggggaagaccccgaccgcgagatgcacagcaagcgtagcaagatggtcctc
ggcgtgggcgacgacgaggtcgccaagctggaggagcgctaccacgagaacgggttcggt
gacctctacccgaagctccgcgagatcggccgcgaggagatcgcggagctggagccgaac
gtcgtcgaggggcgcgaccccggcacggagctgaaggcgcttcagacatccgacggctac
gtggtcgactacggcgtagtcgcggagtcgttcgtcgacgccgcccgcgaggaggagggc
gtctccgtccatctcggaacgaccgtgacgaacgtcgacgaccgcggcgaggagttccgc
gtcgagaccgacgacggcgacttcgacgccgaggcggtcgtcgtcgcggccgggtcgcac
agcctccagttcgccaaggagatggggtacggcgaggggatgtcgctgctaccggtcgcg
ggcagcttcttcctcgcggacgacctgctgaacgggaaggtgtacacgctccagatgaag
aagctcccgttcgcggcggtccacggcgacgccgacgtccatgacgacgggatcacccgg
ttcggcccgactgcgaagctcgtgccggcgctcgaacgcggccacctctcgacggtgagc
gacttcgtcgacgtgtttgggttcaaccccgactcggtcctgagctacgtcaacatcctc
tccgaccggatcctcttcccgtacgtcgttcgcaacctcgtgtacgacctcccggtggtc
ggcaagcgcgccttcctgccggacgtccagaaggtcgtgccgagcgtcggcgtcgacgac
atcgaccgcgcgaaggggtacggcggcgtccgcccgcagatcgtcgacaccgagaacaag
gagctcgacatgggcgaagcgaagatcaccgaggacggaatcctgttcaacatcacgccc
tcgccgggcgcgtcgaccgcgctgaagaacgcgatgacggacatcgagaccgtcctcggc
ttcttcgaggacgactacgagttcgacgaggcggcgttccgcgacgcgactatcgagaac
ttcccgcggctcaacgacgagacggcgggcgacgacgccgcggacgctgatgggaccacg
gacgccgacgcggacgacggggtcgcggtcggggccgacgactga

DBGET integrated database retrieval system