KEGG   Halorubrum sp. BOL3-1: EKH57_14870Help
Entry
EKH57_14870       CDS       T05834                                 

Definition
(GenBank) HAD-IIA family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
halb  Halorubrum sp. BOL3-1
Pathway
halb00627  Aminobenzoate degradation
halb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:halb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EKH57_14870
Enzymes [BR:halb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     EKH57_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase PGP_phosphatase HAD_2
Motif
Other DBs
NCBI-ProteinID: QAU13896
UniProt: A0A410TSZ1
Position
2864958..2865737
Genome map
AA seq 259 aa AA seqDB search
MGFSGAVLDVDGTVVRGDDPIPGAPAGHRRLREVGIETLFVSNNPTKAPPAYVERLGAAG
YEVDADRVLTAGSVTTRYLRRHHGSDDLLCIAEAGLLAQFAEAGLSTTDDVDAADALVAS
IDREFDYEDLCRAMWALEREIPFIGTDPDLVIPAPERDVPGSGAVINAIAGVAERDPDAV
LGKPSDTAVEMVRERLPYPPEECLVVGDRLDTDVALGERAGMTSVLVRSGVTDAADLAAS
DVSPDYVLDHLGEIDRVVG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggattcagcggcgccgtcctcgacgtcgacggcacggtcgtgcgcggcgacgatccg
atcccgggcgctcccgcggggcaccggcggctccgcgaggtagggatcgagacgctgttc
gtctcgaacaacccgacgaaggcgccgccggcgtacgtcgaacgtctcggggcggcgggg
tacgaggtcgacgcggaccgcgtcctcaccgcgggcagcgtgacgacgcggtacctccgg
aggcaccacggcagcgacgacctgctgtgtatcgccgaggcgggactcctcgctcagttc
gcggaggccggactctcgacgaccgacgacgtcgacgccgccgacgccctggtcgcctcc
atcgaccgcgagttcgactacgaggacctctgtcgggcgatgtgggccttggagcgagag
atccccttcatcggcaccgaccccgacctggtgattccggcccccgagcgcgacgtgccc
gggtccggcgccgtgatcaacgcgatcgccggcgttgccgagcgcgaccccgacgccgtc
ctcggcaagccgtcggacaccgcggtcgagatggtccgcgagcggctcccctacccgccc
gaggagtgtctcgtggtcggtgaccgactcgacacggatgtcgcgctcggggagcgcgcc
gggatgacgagcgtcctcgtccggtccggcgtcaccgacgcggccgacctcgcggcgtcc
gacgtgtctccggactacgtgctcgaccacctcggcgagatcgaccgtgtcgtcggctga

DBGET integrated database retrieval system