KEGG   Halorubrum sp. BOL3-1: EKH57_15000Help
Entry
EKH57_15000       CDS       T05834                                 

Definition
(GenBank) gamma-glutamyltransferase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
halb  Halorubrum sp. BOL3-1
Pathway
halb00430  Taurine and hypotaurine metabolism
halb00460  Cyanoamino acid metabolism
halb00480  Glutathione metabolism
halb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EKH57_15000
   00460 Cyanoamino acid metabolism
    EKH57_15000
   00480 Glutathione metabolism
    EKH57_15000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:halb01002]
    EKH57_15000
Enzymes [BR:halb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     EKH57_15000
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     EKH57_15000
Peptidases and inhibitors [BR:halb01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   EKH57_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: QAU13919
UniProt: A0A410TT17
Position
2889850..2891508
Genome map
AA seq 552 aa AA seqDB search
MEPDLDRFTSRRSTVYGQRGVVATSQPLASQAGIEVLREGGNAFDAAVATAAALNVVEPT
STGLGGDVFALYRTADGEVGAMRSCGGAPADATIENVRAALAADDDADSYYPDDGGYAVD
DAGEAGMPFYGPHAVTVPGTARGWEATVEELGRLSLADALSPAIRYATEGYPVSEVIASY
WASADALFTDDHAREAYLFDDEPPSVGQTVTMPRLGESMRTIAEEGADVVYEGEIAEAIA
EEVQSQGGFMTVDDLAEFEVEWPDPVSTTYNGAEVYELPPNNQGLIALEALNVAAELGAG
EHEYDSPERVHCFAEATKRAFHDGHRYITDPDYEGIPPLGSSEWAAERAVGVGETASHDV
SFGVPNANAEDADTALLTVADDAGNVVSYINSRFAGFGSGLVAGDTGIALQNRGASFSLD
AEHPNALEPGKRPFHTLIPGVVRFDEDDWAAFGVMGGYMQPQGHVQVISNLVDYDMPLQR
ALDEPRWRYRESGDLAVEPHFDDDVAAKLVRKDHDVRTLSPVMFGGAQITRNREGVLSAA
TEPRKDGNAQGY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggagccagacttggaccgattcacgtcgcgccggtcgaccgtgtacggccagcgcggc
gtggtggcgaccagtcagcccctcgcgagccaggcgggaatcgaagtcctgcgagagggc
gggaacgcgttcgacgcggcggtcgcgaccgcggccgcgctcaacgtcgtcgagccgacc
tcgaccggactcggcggcgacgtgttcgcgctgtaccggaccgccgacggcgaggtcggc
gcgatgcgctcctgcggcggcgcgcccgcggacgcgacgatcgagaacgtccgtgccgcg
ctggcggcggacgacgacgcggactcctactaccccgacgacggcggctacgcggtcgac
gacgcgggcgaggccgggatgcccttctacggcccgcacgcggtcacggtccccgggacc
gcccgcggctgggaggcgaccgtcgaggagctgggccggctgagcctcgcggacgcgctc
tcgcccgccatccgctacgcgaccgaggggtacccggtgtcggaggtgatcgcctcttac
tgggcgagcgccgacgcgctgttcaccgacgaccacgcccgcgaggcgtacctgttcgac
gacgagccgccgagcgtcggacagaccgtgacgatgccgcgcctgggcgagtcgatgcgg
acgatcgccgaggagggggccgacgtcgtctacgagggcgagatcgccgaggcgatcgcc
gaggaggtccagtcgcagggcgggttcatgaccgtcgacgacctcgcggagttcgaggtc
gagtggcccgacccggtgtcgaccacctacaacggcgccgaggtgtacgaactgccgccg
aacaaccaggggctgatcgccttggaggcgctcaacgtcgccgccgaactcggcgcgggc
gagcacgagtacgactcgccggagcgcgtccactgcttcgcggaggcgaccaagcgggcc
ttccacgacggccaccgctacatcaccgaccccgactacgaggggattccgccgctgggg
tcgagcgagtgggcggccgagcgcgcggtcggcgtgggcgagaccgcctcgcacgacgtc
tccttcggcgtgccgaacgcgaacgccgaggacgccgacaccgcactcctcaccgtggcc
gacgacgcgggcaacgtcgtctcgtacatcaactcgcggttcgccggcttcggctccgga
ctcgtcgccggcgacacggggatcgccctccagaaccgcggggcgtcgttctcgctcgac
gccgagcatccgaacgcgctcgaacccggtaagcggcccttccacaccctcatcccgggc
gtcgtccgattcgacgaggacgactgggccgcgttcggcgtgatgggcggctacatgcag
ccgcagggccacgtccaggtgatctcgaatctcgtcgactacgacatgcccctccagcgc
gcgcttgacgagccgcggtggcggtaccgcgagagcggcgatctcgcggtcgaaccgcac
tttgacgacgacgtcgcggccaagctggtccggaaagaccacgacgtgcggacgctctcg
ccggtcatgttcggcggcgcacagatcacccggaaccgggagggcgtcctctcggccgcc
accgaaccccggaaggacggaaacgcgcaggggtactga

DBGET integrated database retrieval system